eaiovnaovbqoebvqoeavibavo ELF>$@X(@8 @x#x# `#`C`Cx. e$eDeD888$$X#X#X# StdX#X#X# Ptd   LlLlQtdRtd`#`C`CGNUq/j!SG*8,s$ $Q!x`|<ҤB^??  * /~ B R u k K   |r  MCo; W-4 A  L  1. M  R {  |lRq j   *P , EqQF"I 0 ^ *Y e   : wcf 4 n L  ' I k+ - B c@,QW    ef7)Ka s |U90x    c J2  : "u r   ^; S>L  4PE  ~ b5Il%D _;"#*  / " +                 __gmon_start___ITM_deregisterTMCloneTable_ITM_registerTMCloneTable__cxa_finalize__stack_chk_faildm_event_handler_createdm_event_handler_set_dmeventd_pathdm_event_handler_set_dsodm_event_handler_set_uuiddm_event_handler_set_timeoutdm_event_handler_set_event_maskdm_event_handler_destroystrlenstrncmpstrcmp__lxstat64strdupdm_event_get_registered_devicedm_event_handler_get_event_maskdm_event_unregister_handlerdm_event_register_handlerusleepdm_event_handler_get_dsocallocmallocstrncpystrcasecmpfopen64strstr__getdelimfclose__errno_locationstrerrorunamectime_r__ctype_b_locumaskgetenvfgets__xstat64sd_id128_get_machine_app_specificfcntl64stdinstdoutsetlinebufmalloptsetlocalegetpidsyscallsetvbufmemmovestrchr__ctype_toupper_locstrtollstrtodfputc__fprintf_chkstrspnfwritememcpymemsetio_submitio_destroylseek64io_geteventsio_setupsysconfposix_memalignreallocstrcpyalphasort64scandir64opendirreaddir64closedirsscanfudev_enumerate_newudev_enumerate_add_match_subsystemudev_enumerate_scan_devicesudev_enumerate_get_list_entryudev_list_entry_get_nameudev_device_new_from_syspathudev_device_get_devnodeudev_device_get_devlinks_list_entryudev_list_entry_get_nextudev_device_unrefudev_enumerate_unrefmkdirflockunlinkstrtolctimefflushrenamefsyncudev_device_new_from_devnumudev_device_get_is_initializedioctl__fxstat64udev_device_get_property_value__snprintf_chkreadlinkstrrchr__memcpy_chkdirname__xpg_basenameblkid_get_tag_valueblkid_new_probe_from_filenameblkid_probe_enable_partitionsblkid_probe_set_partitions_flagsblkid_probe_enable_superblocksblkid_probe_set_superblocks_flagsblkid_do_probeblkid_probe_lookup_valueblkid_free_probeblkid_probe_step_back__sprintf_chk__ctype_tolower_locgetcstderr__vfprintf_chkfeofversionsort64fdopenrand_raccessferrorfputs__vsnprintf_chklocaltimestrftime__strncpy_chkprlimit64snprintfclock_gettimelocaltime_ropenlogcloselogsd_journal_printv_with_location__vsyslog_chkabortdup2fscanfsd_journal_send_with_locationqsortstrtoul__assert_failstrtoullsysinfoforkwait4execvppipewaitpidgethostnamesigprocmasksigactionsigismembersigdelsetsigaddsetsigfillsetudev_unrefudev_queue_newudev_queue_get_udev_is_activeudev_queue_unrefudev_newgetpagesizegetrlimit64mallinfomlockallmlockmunlockallmunlockgetprioritysetprioritysd_bus_open_systemsd_bus_call_methodsd_bus_message_readsd_bus_error_freesd_bus_message_unrefsd_bus_flush_close_unrefsd_bus_error_has_namestrncasecmpmktimesymlinkrmdirsetmntentgetmntentendmntent__printf_chkputcharoptargoptindgetopt_longgetuidgeteuidnl_langinfoperrorgetppiddirfdunsetenvnanosleeprewindsetsidlvm2_disable_dmeventd_monitoringlvm2_log_levellvm2_log_fnlvm2_exitlvm2_runlvm2_initlvm2_init_threadedsocketconnect__fdelt_chkselect__xmknodmemchrselabel_lookupselabel_opensemctlsemopsemgetstpcpysetfscreateconfreeconis_selinux_enabledlsetfileconselabel_closechownftruncate64gmtime_risspacememccpynearbyintpthread_mutex_lockpthread_mutex_unlockstrndupmemcmplibdevmapper-event.so.1.02libdevmapper.so.1.02libreadline.so.7libsystemd.so.0libblkid.so.1libaio.so.1libselinux.so.1libsepol.so.1libudev.so.1libm.so.6libc.so.6liblvm2cmd.so.2.03BaseLIBAIO_0.4LIBAIO_0.1GLIBC_2.2.5LIBSYSTEMD_222LIBSYSTEMD_233LIBSYSTEMD_221LIBSYSTEMD_209LIBUDEV_183BLKID_2.23BLKID_1.0BLKID_2.17BLKID_2.15GLIBC_2.15GLIBC_2.13GLIBC_2.14GLIBC_2.4GLIBC_2.28GLIBC_2.3GLIBC_2.17GLIBC_2.3.4                0t0 q0    ui  9   z Pb b, b; bJ   #Y  PA e ep A z A      ii   ii  ti ui  `C&hC%pC&xC%CCCmC8CLCaCrCCHClPC8xCCC@C@ Cs(Cf/0Cs8C^@C `HC`PC's`CyhC`pCxC%aCCC5C?CHCdCp(Cy@CXCxpCCCC®CCծCCޮ0CޮHC`CxC CC0CCICeCq C8CPChCCůCCʯCCCCw> C_B(C0CX8C@CHC`ChC pC?xCICSC]CCCCC C8CPChCCUCCC.CHC]Ci(Cy@CXCpCCCC C8CPCCCCC(C@CXCypCCCw>Cw>CE8C Cm(CK80C8CSp@Cw>HCR8PC6XC)F`CV8hC>pCCw>C`C\8C C C C! C! C`k CH C CH C C C C C C C C`k (C 0C 8C @CK HC PC XC `C hCH pCI xC C@I C C I C C C`I Cy CI C C` CI C C C C C CI Cy CI C C (CJ 0C 8C @C HC PC XC J `CJ hCe pC@J xC`J C C0 C CJ C C CJ C CJ C C C C E C C C C C CP C C (CК 0C 8C @C HC PC XC `C K hC pCP7 xC0 C CH C C C C C C C C C C C C C C C C Cw>(CG|0Co8Co@CHCƘPCԘXC`ChCpCxCC(C4C<CDCMC\CnCzCCCCCCΙCۙCCCCC# C0(C=0CGC C׭C CPC XCC CC CpC xC1C CD0C 8CZC CsC@ CPC@ XCC CpCP xCC CCU CC C@PCP] XCC\ CC\ CpC0\ xC(C`[ Cî0CZ 8CήCP( ChC* CPCP* XCؼC ( C׮C CpC' xCC' C80C' 8ChC`' CC0 CPC0Z XC CY CCR CpCY xC0C@ CX0C@ 8CCPK CȾC C#PC@ XCC C@C` C8pCk xCpCX C0CP< 8CC ; C0Cg CpPCpf XCC` CC C0pC 8 xCpC7 C0C@7 8CC CZC0X CmPC XC@Cpo ChCa CpCk xCC^ C00CPl 8CpC^ CCl CPC`_ XC0Cm CC_ CpCpm xCC@` CX0Ch 8CCj CCp CPC`W XCCV C0C0V CXpC] xCC* C0D U 8DD DD DPDT XD8D D˯D0 DۯpD@0 xDpD0 D0D/ 8DD DD DPD0 XDPD DD DpDD xD D`D D!0DD 8D4DC DHDpC DYPD C XDlDB D~DS DpDP xDDpB DH0 D0 8 D D0R Dp D0/ DP D. X D D. D DQ  Dp DP x D@ DPP Dp0 D`L 8 D D D D B D߰P DA X D DA DD0A DpDO xD(Di D/0DM 8DD0 DPD DAPDp XDGD D\D DpD0 xDD`O Dq0Dp 8DD DD  D8PD XDpDO D(D0' DpD' xDD& D0D 8D(D DPDh DPDP XDD DDp DpDp xD8DP. D0D) 8DhDN DDN DPDi XD/DPM DD DApDL xD(D Dڱ0D) 8DDP) DD& DPD( XDD D0D) DFpD( xD^D D0D0 8DD D0D D0PD XDhD D DP  Dp D x D( D D0!D 8!D!D !DP!D !DsP"D X"D"D "D#D0 #Dp#D x#D#Dh #D0$Dpj 8$D$D $D($Dp $DPP%D X%D%D %D&DH &Dp&DH x&D&Dp &D00'D 8'DX'DJ 'D'DG 'DP(D7 X(D(DG (D)DG )D p)DP x)DX)DP )D0*DP 8*D*D *D*DE *DXP+Dj X+D+D`@ +D,D ,Dp,D- x,D,D0@ ,DP0-D6 8-D-D0 -D-D@ -DP.D X.DX.D0 .D/Dh /Dp/D? x/D/DP? /D(00D> 80Dp0Dp> 0D0D> 0DP1D= X1D@1D2 1Dp2D 2Dp2D- x2D2D, 2D03D, 83D(3DJ 3DP3DK 3DxP4Dp6 X4D4D+ 4Dײ5Dm 5Dp5Dn x5D5D6 5D06D5 86D@6D 5 6D6D4 6DhP7D@4 X7D7D3 7D8D`3 8Dp8D2 x8D(8D@1 8D`09DpI 89D9D 9D9D 9Dh:D&p:D3x:D` :Dw>:Dw>:D :D<:D :D@:DO:D :DS:DO:D ;Dn;DO;D (;D0;DO8;D H;DP;DX;D h;Dp;Dx;D0 ;D;D;D@ ;D̳;D;DP ;Dw>;Dw>;D;DO(;Dh (h=D KD=DE=Dw>(=DKD0=DE8=Dw>H=DKDP=DEX=Dw>h=DJDp=DEx=Dw>=DJD=D`E=Dw>=DJD=D@E=Dw>=DJD=D E=Dw>=DJD=DE=Dw>>DJD>DE>Dw>(>DJD0>DE8>Dw>H>DJDP>DEX>Dw>h>DpJDp>DEx>Dw>>D`JD>D`E>Dw>>DPJD>D@E>Dw>>D@JD>D E>Dw>>D0JD>DE>Dw>?D JD?DE?Dw>(?DJD0?DE8?Dw>H?DJDP?DEX?Dw>h?DIDp?DEx?Dw>?DID?D`E?Dw>?DID?D@E?Dw>?DID?D E?Dw>?DID?DE?Dw>@DID@D E@Dw>(@DID0@D E8@Dw>H@DIDP@D EX@Dw>h@DpIDp@D Ex@Dw>@D`ID@D` E@Dw>@DPID@D E@Dw>@D@ID@D E@Dw>@D0ID@D E@Dw>AD IDAD` EADw>(ADID0AD E8ADw>HADIDPAD EXADw>hADHDpAD ExADw>ADHDAD EADw>ADHDAD EADw>ADHDAD` EADw>ADHDAD0 EADw>BDHDBD EBDw>(BDHD0BD E8BDw>HBDHDPBD EXBDw>hBDpHDpBD` ExBDw>BD`HDBD EBDw>BDPHDBD EBDw>BD@HDBD EBDw>BD0HDBD EBDw>CD HDCD ECDw>(CDHD0CD E8CDw>HCDHDPCD` EXCDw>hCDGDpCD@ ExCDw>CDGDCD ECDw>CDGDCD ECDw>CDGDCDECDw>CDGDCDECDw>DDGDDDEDDw>(DDGD0DDE8DDw>HDDGDPDD`EXDDw>hDDpGDpDD@ExDDw>DD`GDDD EDDw>DDPGDDDEDDw>DD@GDDDEDDw>DD0GDDDEDDw>ED GDEDEEDw>(EDGD0ED`E8EDw>HEDGDPED@EXEDw>hEDFDpEDExEDw>EDFDEDIEDw>EDFDEDIEDw>EDFDEDEEDw>EDFDEDEEDw>FDFDFDEFDw>(FDFD0FDE8FDw>HFDFDPFDpEXFDw>FDw>FDw>FDw>FDw>FDw>FD$ FD$ FDw>GDGD(GD8GD;HGD1XGDehGDxGDGDGDGDGDGDGDGDGDHDHD(HD8HDHHDXHDhHDxHDHDHDHDHDHDHDHDHDIDID(ID8IDHIDXIDhIDxIDIDIDIDIDIDIDIDIDJDJD(JDp8JD1HJDeXJDhJDxJDJDJDJDJDJDJDJDJDKDKD(KD8KDHKDXKDhKDxKDKDKDgKDDKD}KDhKDKDtKDKDLDLDLD LD0LD8LDHLDPLD`LDhLDxLDLDLDLDLDLDLDƵLDLDʵLDLDѵLDMDյMD MD޵(MD8MD@MDPMDXMDhMDpMD4MDMD4MDMD4MDMDLMDfMDLMD*MDLMDNDdNDNDd(ND_0NDd@ND HND|XND `NDpND͵xNDNDNDNDNDNDNDND NDND#NDOD+ODOD/ OD0OD88ODHOD<POD `ODBhOD xODFODODLODODPOD$ODTOD0ODYOD0OD]OD<PDbPD< PDf(PDH8PDm@PDHPPDqXPDThPD{pPDTPDPD`PDPD`PDPDlPDPDlPDPDxPDQDxQDPQD5hQD?QDHQDdQDpQDyQDQDxRD(RD@RDXRD®pRDRDծRDRDޮRDޮRDSDSD 0SDHSD0`SDxSDISDeSDqSDSDSDTD TDů8TDPTDʯhTDTDTDTDw>TD|TDWUDUD0UDHUD`UDUDEUD@EUDUDUDpUD@VDPVD0(VD 8VDHVD@XVDhVDxVDVDVDpVDVDrVDeVDrWDWD~0WDHWDr`WDlxWDWDWDuWDrWD WDrXDwd XDIm8XDPXDrhXDrXDrXDXD8PYDXYDPYDYDPpZDxZDPZDZDPH[D[P[DcX[Dh[Dw>p[Dw>[Dpl[D[D[D[D@[D[D[Dp\Dp\D (\D=8\D?H\D?X\DBh\D x\D\D\D\D \D\D\D\D\D ]D]D(]D8]DH]DX]D`h]Dx]D]D`]D]D]D]D]D`]D`]D^D^D(^D@8^DH^DX^Dh^D0x^D0^D0^DP8oDPQ@oDGPoDXoDc `oDoDGoD@OoDJoD8oD@/oDpDpDpDpD pD pD(pD pD0pD0pD8pD0pD@pD@pDHpD@pDppDxpD0pDpDpDpDpDpDqDqD qD(qD8qDXqD`qDPhqDqD %qD?qDIqD7qD0-qD,rD&rD@ PrD %XrDPD`rDhrDFrD,rD&rD@ rD`8sDh}psD9sDQsD`sDmtD(:(tD`tD`:xtD%AtD:tD`uDh;uD3PuD;huDuDںvDB?@vD;XvDrvD;vDvD`vDa0wD<HwDMbwDP<wD`wD=wD`wD@xD xD>8xDѪHxD`pxD8>xDb*xD`xD>xDa(yD a`yD>xyD*ayDyyD@yDo8yD-ozDAzDFaPzDChzDVazD0FzD`zDfazD(G{Dua{D@{DGX{Dnh{Da{DJ{Da{Da{DO{Dޯ|D|DH|DaX|Dh|DP|Da|Dw>|Da8}DAp}DXQ}Da}DR}Da~DR(~Da`~DUx~Da~Db~DU~D)bD`VD@b(DPDPXhDTbDXZDpbDZDb@DH\XDbD]DbD_Da0D aHDbD0cDbЁDcDb8DbpDhDcDPh؂D#cD i(Dk`DkxD2cDnȃDJcDnDYcPDxqhDhcDycDrDXtDtDx@D8xXDcDxDyDyDcD(Dz0DcHDcDXzDDІD{Dק D@|8DpD|DDX}؇DcDD}(Dc`DxDD؀ȈDdDD(dPDhD7dxD̷D`DJdȉDfdDȂDnd@DXD|dhDD DdDDd0DȆHDdDDdЋDPDd D8DdpDDeD،D,eDЋ(DFe`DxD[eDHȍDteDDePDhDeD DeD@De@DXDeDxDeDDe0D@HDfXDDDfАDpD D8D&fpDD9fDJfDPؑDVfDDx(Dgf8D`D0xDoaDȒD}fDPDfPDhDf/D@DaDDf@D0XDfDhDfDDf0DHHDaXDJDDЕDDf8DfHDpD@D@DXDؖDRDXD(D%A`DXxDfDD`DȗDDDf(D8DpPDxhDfDЫDfDDf@D(XDgD`DtDЬDkDD0D@HD gDhD`eКDxD D 8D!gDhD؛D2g(DCgxDVgDUgD[gȜDzg؜DygD~gD(DghDgD`DgDgXDghDgxDgDD hDXD h0DHD,hXDDDiDiDiФDDiD jD!j DH8D1jHDHjXD^jpDDpjDDإDjDjD (Dj`DXxDjDȦDjئDjDjDDk(Dk8D3kPD@hDDkxD\kDskDDkȧDDDkDj@DpXDkhDkxDkDDkDjD Dk0D`HDlXD#lhD3lDPD@lDyЩDDQl DX8DMbpDD`lDmlDتDlD(Dl`DHxDlDȫDlDDlPDhDlDDlȬDDhDl@DXDmDDmD`D%m0DHDFmDhD6mЮDhDRm DH8DhmhDpDD{mD دD?XD(Ds8D`DxDmDmDHȰDmذD0DDm(DmPDhDmxDeDDDmDDn@DXDhDD3nDp DPn0D HDnnD DnгDDn D8DUapD@DnDشDnD`(Dn8Dn`DxDnDȵDnDxDnPDhDoDD%oDDf@DHXDWlDD@oDD( DOo0D@#HD)D`oDeo8DpoDzoعD(DxDoDoD#ȺDoD%Do(Dw>PD0'hD\D(DjD(Dd@D*XDhhDm>D@*DoDoDp*Dd0D*HDkD*DoнD+Do Dh+8DoHD ppD@,DpD&pD=ؾD3pDp>D>(DAp8Dp>`D ?xDWpD`pD?ȿDppؿD@D@Dyp(D@PDAhDpxDpD8BDpDBDBDpDPC@DCXDphDpD(DDpDDDDDpD0E0DpEHDpXDpDEDqDpFDFD(qD G DpG8DpHDqpDGDqDHDGD&qDHD@I(D:q8DHq`DIxDOqD]qDPJDdqDrqDJDyq(DqPD@KhD{qxDqDKDqDpDHLDqDp@DLXDqhD`pDHMDqDqDMDqDr0D`NHDrDND)rD ODArDO DO8DPrHDPD]rDQD0QDnrD@RD`R(Dkm8D{r`D`SxDrDrDTDmD{rDUDj(Dr8DrPDVhDrDVDKSD@WD@DYXDrDZDrD8\Ds0D]DpwDwD xDwDw8DzHDPyD0yDDDDDD 2DP(D@D`0D$D6D 6D5 D7(D50DpPDpSXD0S`DDhDCpDCxDPCD<DDDpDDDD D`DDPD DDDDPD`D D s(D0D@c8D@@DHDPD0XD`D`hDPDDX DPW D`b DT D] DO D\ D[ D@Z DO DO D`O D0O hDDpDpD xD Dp Dp D D D Dp D@ D D D D D Dq D (D 8DhpPD XD hDD D DD` D DD0 D DD D (D@D HD XDpD xD DȣD D DޣD D DD D D0D 8D HD`D hD xDD D D1D D D@D D DS D (D 8DePD XD hDrD D D|D D DD D DD D (D@D@ HD XDpD` xD DɤD D DפD D DߤD D D0Dp 8D HDe`D hD xDDP D DD0 D DD D D D (D 8D1PD XD hD@D D DTD D DhDp D DyDP D (D@D0 HD XDpD xD DggDP D D8gD D DDP D Dͥ0D 8D HDե`D hD xDD D DD D DhD` D D D0 (D 8DPD XD hDD D D D D DDp D D*D@ D (D2@D HD XD?pD xD DGD D DRD D D^D` D Df0D0 8D HDv`D hD xD~D D DD D DD D D D (D 8DPD XD hDDp D D̦D D DۦD D DD D (D@D HD XDpD xD D(D D DD D D$D0 D D50D 8D HDB`D hD xDD D DOD D DaD D Dt D (D 8DPD XD hDD D DD D DD D DЧD D (D@D HD XDpD xD D D D DD D D,D D D<0D 8D HDP`D hD xDcD D DyD D DD D D D (D 8DPD XD hD¨D D D٨D D DD D DDP D (D@D0 HD XDQpD xD DD D DpD D DD D D0D 8D HD'`D hD xD3Dp D D?D D DD` D DJ DP (D 8DRPD0 XD hDZD D DbD D DjD D DyD D (D@D HD XDpD xD DD D DD D DD D Dé0D 8D HDթ`D hD xDD D DD D DD D D D (D 8DPD XD hD"D` D D)D@ D DpD D D1D D (D9@D HD XDHpD xD DVD D DbD D DtD D D0D 8D HD`D hD xDD D DD D DD D D D (D 8DĪPD XD hDЪDp D DݪDP D DD D DD D (D @D HD XD/pD xD D6D@ D D"D` D DD0 D D+0D 8D HD4`D hD xD?D D DHD D DPD D D[ D (D 8DhPDp XD hDzDP D DD0 D DD D DJfD D (D)@D HD XDpD xD DD D DD@ D DAD D D̫0D 8D HDȫ`D` hD xDثD D DʜD D DD@ D D' D (D 8DPD@ XD hD|D D DcD D DD D DD` D (D7@D HD XDpD xD D rD D DD D DD D D0D 8D HD`D hD xDDP D D)D D D7D D DQ D (D 8DNPD XD hD_D` D DקD D DD D DkD D (D{@D HD XDdpD xD DdD D DD D DE E EFe0E 8E HE`E hE xEլE E EeE E EeE E Ee E (E 8EePE XE hEeE E EeE E EeE E EfE E (Ef@E HE XEpE xE EqE E EE@ E Ew>E E 0E EEEw>EEEEEEEEEE EE(E(E0E(EE E(Ew>8Ew>hEhEpEhEEEEEEEEEEEEE@E@EHE@EPEPEXEPEpEw>xEsEw>EsEw>EsEw>EsEw>EsEw>Es@EHEPE`EhEpE)EE;ENEZEE1EDE6EeE})Eo EL(E@ELHE`ELhEELEELEELEELE EL E Ez( E,0 E@ EzH E,P E` Eh E E E E~ En E E~ En E Eeh E Eeh E E( E0 E8 E` Eh Ep Ex E E Eɴ EԴ E E Eɴ EԴ E E E0 E8 E` Eٴh Ep E Eٴ E E E Ee E E Ee E E E E E E( E0 E8 E` E h Ep Ex E E  E E E E E E! E E( E0 E!8 E` E)h E5p E E) E5 E E; Ehu E E; Ehu E EqW EEqWE E&W(E@E&WHE`EMhESpEEMESEEZEhEEZEhEEmE1EDE6 Ee(E})0Eo@EhHE`EhhEEaEEaEEtsEEtsEEE E(E@EKHE`EKhEE6EE6EEE]EEE]EETE ET(E@EHE`EhEEQuEEQuEE!EEsEwEp{ E} (Ex @Ew PEv XE| `E{ hEpv pE@v xEv E E E E Ep E` E0 EP E E E PE XE hE xE@ E E E E E` E E E E 0EP 8E @E HE PE XE `E E E E E@ E Ee(Ex0E8EP@EHEJPE{XE`EQpEpExEpEEEEEE E0EEEpE EEpE@ E0EP8E@EHE0XE`ExEEpE Eh}E8E`l`"E?h"Epx"E.E?.E8.EP_9E"?9E9El@EE*?HEE5?XEEPEpPEI?PE0Q\Ec?\E\E@# hE(hE8hEPsE#QsEk?sE@`EiQhE?xEPE?EEEE?E @E?HEHXE$E?E8EplE?E?EБ E?(E8EE @E@E#`E)@hE0@xE#EG@EE`E=EE@EeHE(XE FN@ FW@ F0FFo@F "FƜ("FX8"F-F@-F-F`9F@h9Fx9FpEF@EFEF@0PFm~PFPF [@\F@H\F8X\F@$gF@gFpgF bsFcXsFsF`| F@(F8F`F@ȊF@؊F`F`hFxF0F@F@F F@FAFP$@F3jHF@XFOFFFp$FFF P F A(FЊ8F F,AFF`F9AhF xF7FBAF@FD GGA Gp G%@Gv~HGQAXGpE!GgA!G!GP-GqA-G-GT 9GzA(9G89GYDGADGDG ^`PGAhPGAxPG`_\GA\GH\GwgGAgGAgG{@sGAHsGxXsG~GA~G~GPGeGAG G B(GB8GG+BȡGءG `G/BhG6BxGGSBGG @GuXG&`GuhGuGuGuGuGuGuGuG0:GuGuG vG@GvGuG0B Gu(Gv0G v@GBHGvPG vXG*vhGBpG5vxGvGPGTwXG^w`GiwpG?xGuwGwGhwGp?GtwG|wGwG?GwGwGwG?GwGwGwG@Gw Gw(Gw8Gp@@GwHGwPGw`GpFhGxpGwxGaxGCGnxGPxG xGpCGxG"xG7xGCGDxGMxG`xGCGmxGvxGx(GpD0Gx8Gx@GxPG>XGx`GhGxxG DGxGH}GxG`EGxGx}GxGEGxG}GxG0EGyGyG!yGE G/y(G9y0GJy@GGHG_yPGpyXGyhGHpGyxGyGLyG0HGyGyGyGHGyG~GyG IGyGyGyG0IG zGz G!z0GI8G2z@GGUGGUGHGUG3t GU0Gt@GUPGKj`GVpGޯGUG]GUGkGVGkG VGVG(VGtH G3V0G@GGVGw>GVGVGVGVGVGW GW0G W@G.WPGDW`GYWpGkWG|WGWGWGWGWGWGWG XG"XG9X GOX0G]X@GjXPGyX`GXpGXGXGXGXGXGYGYG1YGKYGdYGxY GY0GY@GYPGY`GYpGYGYGZGZG)ZG G[8GXG[pG[G@G\G\GG)\G4\GG=\GH\0G(8GQ\PG\\hGPpGe\Gq\GxG{\G\GG\G\GG\0G\HG0PG\hG\GG\G\G0G\G\GG]G](G0G%]HG<]`GhGQ]G`]GGh]G]G G]G]G`G](G]@G]HG]`G]xG]G^G*^GG8^GF^GR^Gm^Gw^ G (G^@G^XG`G^xG^GGcG^GxG^G^G^G_ G_8G`@G_XG1_pGxGA_GY_G(Go_G_GhG_G_G G_8G_PGxXG_pG_GGaG_GG_G`GpG`G`0Gx8G'`PG8`hG(pGG`GP`GGW`Gi`GHGy`G}aGG`0G`HGPG`hG`GG`G`GG`G`G(GaG!a(G0G8aHGMa`GPhG`aGyaGaGaGaGGaGaG@Ga(Ga@GhHGb`GbxGpG!bG-bG`G7bGBbGGKbG]b G(Gmb@GybXG`GbxGbG8GbGbGGbGbGGb Gb8G@GbXGbpGbxGnnGcGG&cG0cGG8cGIcG GXc8GjcPG`XGzcpGcGGcGcGPGcGcGGcGc0G8GyfPGchGpG dGdG`G@nGdGG1dG?dGGKd0G[dHGPGidhGudG GdGdGGdGdGGdGd(GH0GdHGd`GhGdGdGGeGeGeG-eG?eHHOe(H\e@HHHge`HrexHH{eHeH@HeHeHHeHe H(He@HeXH`H9kxHfHHiH fHHfH%fHxH5f HFf@HUfXHffpHxHufHfHHfHfHHcHfHp Hf8HfPHXHfpH gHpHgH6gHHOgHegHHygHg0H8HgPHghHXpHgHgHHmHgHHgHgHHg0HgHHPHhhHhHHhH*hHH/eH9hHPHGhHZh(H0HkhHHvh`HhHhHhHhHhHhH HhHhHHh(Hh@HXHHh`HhxHHiHiHH*iH;iH@HJiH\i H(Hli@HiXH``HixHiHHiHiHHiH) H Hi Hi8 H@ HmX Hjp Hx Hj Hj H0 H$j H1j H@  H8HcqPHyqhH@>pHqHqHx>HtHqHFHqHqHqH3]0HqHHGPHqhHqHHJHqH rHJHrH'rHJH;rHTr(HPL0HkrHHtr`HLhH=cH{rHMHrHrH0THoHrHTHr(Hr@HUHHr`HrxHXVHrHrHrHsHVHsHs HHZ(Hs@H5sXHZ`HJsxHYsH[HfsHrsH[H|sHsHs Hs8H\@HsXHspH`]xHsHsH^HsHsHsH*HX^ Ht8HtPH^XH]cpH1tHxbH$H$H%H$H%H%H%H%H %H %H(%H %H0%H0%H8%H0%H@%H@%HH%H@%Hh%Hw>%H` %H%HP%H%H(H%H (H8&H8&H@&H8&Hp&Hp&Hx&Hp&HH(Hk[(Hw>)H)H )H)H0)H0)H8)H0)H@)H@)HH)H@)HP)HP)HX)HP)H`)H`)Hh)H`)H)Hw>JHJHJHJHJH2JH1 JH ZD@JHlPJHoXJHohJHopJHJHJHt^JHJH8JHJHh>JHJHJHJH>JHKH>KHKH(KH0KHK@KH`KHpKH`xKHKHKHKHKHKHKHKH@KHKHxKHLHLHr^LH LH0LH8LHHLH@PLH%`LHphLHxLHLHCLHILHm>LHMLHVLHLHZLHdLHwLHhLHrLHMHvMHMHMH MH(MH 0MH8MHn@MHHMHPMHXMH`MHhMHpMH'xMHMHMHyMHMHMHmMHMHMHS=MHMHMH*MHMHMHMHMHNHmNHMNHVNH NHZ(NHd0NHw8NHh@NHrHNHPNHvXNH`NHhNHpNHxNH NHNHNHNHNHNHNH NHNHNHNH%NHjNHNHNHNHHoD!hoDIpoDQxoDRoDYoD\oD^oDoDoDoDgDgDgDgDgDhDhDhDhD hD (hD 0hD 8hD @hDHhDPhDXhD`hDhhDphDxhDhDhDhDhDhDhDhDhDhDhDhD hD"hD#hD$hD%hD&iD'iD(iD)iD* iD+(iD,0iD-8iD.@iD/HiD0PiD1XiD2`iD3hiD4piD5xiD6iD7iD8iD9iD:iD;iD<iD=iD>iD?iD@iDAiDBiDCiDDiDEiDFjDGjDHjDJjDK jDL(jDM0jDN8jDO@jDPHjDSPjDTXjDU`jDVhjDWpjDXxjDYjDZjD[jD]jD_jD`jDajDbjDcjDdjDejDfjDgjDhjDijDjjDkkDlkDmkDnkDo kDp(kDq0kDr8kDs@kDtHkDuPkDvXkDw`kDxhkDypkDzxkD{kD|kD}kD~kDkDkDkDkDkDkDkDkDkDkDkDkDlDlDlDlD lD(lD0lD8lD@lDHlDPlDXlD`lDhlDplDxlDlDlDlDlDlDlDlDlDlDlDlDlDlDlDlDlDmDmDmDmD mD(mD0mD8mD@mDHmDPmDXmD`mDhmDpmDxmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDmDnDnDnDnD nD(nD0nD8nD@nDHnDPnDXnD`nDhnDpnDxnDnDnDnDnDnDnDnDnDnDnDnDnDnDnDnDnDoDoDoDoD oD(oD0oDHHgBHtH5b`B%c`Bhhhhhhhhqhah Qh Ah 1h !h hhhhhhhhhhqhahQhAh1h!hhhh h!h"h#h$h%h&h'qh(ah)Qh*Ah+1h,!h-h.h/h0h1h2h3h4h5h6h7qh8ah9Qh:Ah;1h<!h=h>h?h@hAhBhChDhEhFhGqhHahIQhJAhK1hL!hMhNhOhPhQhRhShThUhVhWqhXahYQhZAh[1h\!h]h^h_h`hahbhchdhehfhgqhhahiQhjAhk1hl!hmhnhohphqhrhshthuhvhwqhxahyQhzAh{1h|!h}h~hhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1%QBD%QBD%QBD%QBD%}QBD%uQBD%mQBD%eQBD%]QBD%UQBD%MQBD%EQBD%=QBD%5QBD%-QBD%%QBD%QBD%QBD% QBD%QBD%PBD%PBD%PBD%PBD%PBD%PBD%PBD%PBD%PBD%PBD%PBD%PBD%PBD%PBD%PBD%PBD%}PBD%uPBD%mPBD%ePBD%]PBD%UPBD%MPBD%EPBD%=PBD%5PBD%-PBD%%PBD%PBD%PBD% PBD%PBD%OBD%OBD%OBD%OBD%OBD%OBD%OBD%OBD%OBD%OBD%OBD%OBD%OBD%OBD%OBD%OBD%}OBD%uOBD%mOBD%eOBD%]OBD%UOBD%MOBD%EOBD%=OBD%5OBD%-OBD%%OBD%OBD%OBD% OBD%OBD%NBD%NBD%NBD%NBD%NBD%NBD%NBD%NBD%NBD%NBD%NBD%NBD%NBD%NBD%NBD%NBD%}NBD%uNBD%mNBD%eNBD%]NBD%UNBD%MNBD%ENBD%=NBD%5NBD%-NBD%%NBD%NBD%NBD% NBD%NBD%MBD%MBD%MBD%MBD%MBD%MBD%MBD%MBD%MBD%MBD%MBD%MBD%MBD%MBD%MBD%MBD%}MBD%uMBD%mMBD%eMBD%]MBD%UMBD%MMBD%EMBD%=MBD%5MBD%-MBD%%MBD%MBD%MBD% MBD%MBD%LBD%LBD%LBD%LBD%LBD%LBD%LBD%LBD%LBD%LBD%LBD%LBD%LBD%LBD%LBD%LBD%}LBD%uLBD%mLBD%eLBD%]LBD%ULBD%MLBD%ELBD%=LBD%5LBD%-LBD%%LBD%LBD%LBD% LBD%LBD%KBD%KBD%KBD%KBD%KBD%KBD%KBD%KBD%KBD%KBD%KBD%KBD%KBD%KBD%KBD%KBD%}KBD%uKBD%mKBD%eKBD%]KBD%UKBD%MKBD%EKBD%=KBD%5KBD%-KBD%%KBD%KBD%KBD% KBD%KBD%JBD%JBD%JBD%JBD%JBD%JBD%JBD%JBD%JBD%JBD%JBD%JBD%JBD%JBD%JBD%JBD%}JBD%uJBD%mJBD%eJBD%]JBD%UJBD%MJBD%EJBDfD.9HP%9HtR)t*AL$F1LZH5MAoZEH=9HHtٿH8H 8F8HXSH=Ht 8HH=[FjHHtH5GSHu F[H5HtH5JKHuF[ÐH=(FH(FH9tH.IBHt H=(FH5(FH)HHH?HHtHHBHtfD=e(Fu+UH=HBHt H=ΧAd=(F]wAWMIAVIAUAATMUSHHXdH%(HD$H1$Eu AG\ 1LT$MtM\$HHk HD1EHLLATUARD$D$$ H Ņl$Ht-HD$HD$ CHD$(HC D$0CHD$HCHL$HdH3 %( HX[]A\A]A^A_L$W L$V L$ DLL$̕L$H)LI1ɺ1H5Erf.LL$TLT$L$HL\$HE1E1j11LjLARLT$ H L$L\$tD$E1AcL1ɺ1H5 ff.fAWAAVEAUIATIUHSHHHI$HteHHtHHLHuNDHsDHhHH[]A\A]A^A_fD1LHI$|L1ɺ1H5H1Ly1ɺ1H5uDLQ1ɺ1H5MDL)1ɺ1H5%_"f.AWAVAUATUSHXdH%(H$H1HHLL9E1Ll$@L|$f.HEELHPPL@H1HHD#HHHL2H߅u?H1DH$HdH34%(9HX[]A\A]A^A_HLH߅tFAT$D$ /#HHHL82H߅u91l@1L1ɺt H51@#H߉D$ D$ HmAL9D1L1ɺ H5W11L1ɺ H5/1cAWAVIAUAATUHSHHHFPH&DH=7"FI菤HgH1ɺoPH51L "FLHY^HL-/hL{A`<@HEPLLHuC'fL}1cH5r Lr1ɺh1H5r`f.H1VATL}AUI1H5arXZJ@MkLd}H51r11gfL r1ɺ1H5r?f.M}L4}UDAUIHE1ATE111USHHHGPH83tOHCPHH8 IHtgLHH L H[]A\A]f.L7|1H50qjH[]A\A]D1Lp1ɺH5p15H[]A\A]ATIUSHHdH%(HD$1HGXH-H2HCPHH8 Lup1ɺHHLHL$HH ¸HL$dH3 %(H[]A\HHH4HHXHCXH2THL{I1H5o 1rfH D$\Lo1ɺ1H5o14@HHL{If.AUIպATAUHSHdH%(HD$1HGPHH8a Ln1ɺHtdDLD$LHHH t$HL$dH3 %(uGH[]A\A]H T$tLn1ɺH5n11ff.AUIպATAUHSHdH%(HD$1HGPHH8 Ln1ɺHtdDLD$LHHH t$HL$dH3 %(uGH[]A\A]H T$tLm1ɺH5m11ff.ATIUHSHdH%(HD$1HGPHH8 HtqHHL$LHH Ņt%HM HT$dH3%(u`H[]A\fD$tLl1ɺ1H5l'DLl1ɺ1H5l16fDAUATIUSHHHWXdH%(HD$1HGPH HHH8 LQl1ɺ/HtcLD$LHHI= t$HL$dH3 %(uGH[]A\A]L( T$tLk1ɺ4H5k11VfDUH1SHdH%(HD$1Ht5H$P H8UHL$dH3 %(u1H[]DLWk1ɺBH5Uk1fDAUE1E11ATIHUSHHHGPH8uH[]A\A]f.HSXHCPH HH8H IHt&LHH L H[]A\A]ÐLj1ɺ[1H5j1qAUIATUSHZŅIM1L9u>fHL9t-H{o tHsI}HL9uHA1ALvH5i XZH[]A\A]f.AVAUIATUSH0dH%(HD$(1ŅIM1L9tRI @HL9tAH{蟊 tHsI}E11ALthL$1HL9uHA1ALjH5h%XZHT$(dH3%(u1H0[]A\A]A^Lh1ɺwH5h@ff.HdH%(HD$1D$F@t!HF H@XHt51HT$Ѕt(D$t!HL$dH3 %(u4H1LjtH5 hD1{ff.HGPHH8ff.fATUHSHGXHH"H!r|1H u-HEHsHHxPKIHtHĈ ,@HEHsHHxPKIHtH藈 GAD[]A\ÐHHHxPKIHt@\jHZHUHuLKAą?Lf1ɺ1H5fDHHHxPJIH@\HHUHuLAąLQf1ɺ1H5Mf fHUHuLAąLf1ɺ1H5 fDHH HCXH輄 tL谄 yHUHuLAą^Le1ɺ1H5e>HHHxPAIIH@ZHSHUHuLAąL e1ɺ1H5e?f.ATUSHGX@uj ueH%IHt_HCPE1E11ɺHH83t?HuH H˅ Ņt5[]A\fH߽cu[]A\HLae IH5d1QI$ 2fH]HHCXIRUSHH $H1dH%(H$1HHHHH= H_H$dH3 %(u H[]ͼff.fAUATUSHAHHHHHIMHHA1HHeHH1Ht#uAH9H[]A\A]@H@t AE%A$Lib1ɺ1H5eb1LAb1ɺ1H5=b1uH[]A\A]L b1ɺ1H5b?H[]A\A]fLa1ɺAVAUATUSHIHHHEELa1ɺHHAHDHELAAL\a1ɺHHHEuY̼HAEt`L bH11SLbH5aOXZ[]A\A]A^胱HAhL @bEuL`1ɺ1H5`[1]A\A]A^L`1ɺAWfAVAUIATIUSHrHdH%(H$1)$D$HD$L)$)$DŽ$Ht BHӉ$ % IEXH.rH/rxCAE\ IEPE1HL$PLAH8PDt$XALqHL9lIAVmDLEH ,H HxG] tH!8QL HL NRL`P1H5 _EXZH$dH3 %( H[]A\A]A^A_tL 0 L} tDsED$(LDIIHD$Mt+IHtDHtH@@ ML;t$qHMHD$HDLl$H$HHEHD$8HT$0DEVL1Et#H@IHЃ8KA9^LwIHtH$LPIHtH$L^IHt1҉LnIFHP€}AF1 rH@ H@pHa0IvpI|$D$HD$L"H]A11HLtHH1HEL\11_H5\H$IF@I~]H1ɺePL DL1LiH5f\蠾AZA[1WD;! 9;fDD{Eu0Lw| t$IEP1H LHHxG SI1LHpHÅL[1ɺ1H5[LxHhL jDHp1҉LLa[1ɺ<H5Z[虽D$(q@Ll$LL|$HLLLЅD$HOT$LKH|$L\1ɺwIH5Z1%  M6L;t$Ll$DL$(E ÅTLxH5\L JLDH1ɺPLQhH5qZ1讼_AXhfDLIZ1ɺIH5BZ聼D$(@LZ1ɺPH5ZQD$(v@LY1ɺVH5Y!D$(f@D$LIFH@ Hxx H|$H[IFHDT$8HX0HT$ ZHT$ 1LJ[IH5nY1R{S蟻IFAXAYH@ HXx bHY1LӅըuHD$@^Ld$ 1Ld$l$,Hl$0YL$H(LH1ɺUILefH5X1i'XZ®IFLLLD$HH@ Ppu1ɺl$,L[XH5`XLd$ 蚺D$(M6L;t$Dm\$(Ld$ l$,CD\$LE1D$(%DIvH8HD$HHtI|$HD$HH[t D$H%H߉D$LL$Ht$LHD$H8 HXH|$HD\$81H5AWSIL6Y1t$ e^_^ 6IFHT$@tIVpHt$E11A L Ll$LL|$HD$LH|$LX1ɺILV1ɺTH5V͸HHHH$H߅$7L2V1ɺH5+VjD$( LV1ɺW1H5V<S1D$(Lt 8IML9!D$(L8Hp1҉LM9LM?LOLKb IH5`U1蘷UI1҉LL!U1ɺ1H5UYMD$(L;t$;f.I~pULT1ɺ1H5TLT1ɺ%H5TD$(I~ZH1ɺkPL ^LaLl$L|ALH!H1ɺIULaLT1ɺfH5TWH菦fLl$LL,a1ɺIH5S1Mff.fAWAVAAUIHATUHSHHHdH%(HD$81^r uH0HEX HODKDSHpUIEHDEtHEXL%cUH%6EHHaUHT$L=LDHLgUHT$I1H5RR ATAWDCH EHL˻C$HHC&AąH5UL > HHLAHL$8dH3 %(DHH[]A\A]A^A_DSHL$E1E1HLAą|$8EKt E\ T$y> lCHp LLM9ujf.M$$M9SI|$17ufDC HJD[[L%lSHELDH#THDATLuS1SIH5Q1L]A\AfDH$L%SHSLEt$LP1ɺ0 H5P+@LP1ɺ+ 1H5}P跲fLYP1ɺ 1H5UP菲f.1H5HAą^LP1ɺ 1H5OE14H5]RLY; Off.@AWAVAAUIATIUSHHHdH%(HD$81 HAXtfH 3HQPH@uKHHHj HCPHA$tHCXH+H߉ŅcK& H߅&p EAEAu A}HH /QEEL=/QL59PH-<HDʅHLDLDEHL$HD<HL$LQ IH5MN1QAWAVUzH 1HHL$LŅL$tT$u D$(1H9H5QL8 LHZŅ(H5qQLA9 LHLLM1ɺ7 1H5MůaHAPH@_HCX1 LJ\IH5,M11bHt$8dH34%(HH[]A\A]A^A_DH 3C[uHhH@[L[11 H5LHhL[ IH5yL1豮J@H0 LZIH%HCPH@HxAEI]()f.LkN1ɺ IH5K1DLK1ɺ3 1H5KǭH5(OL6 QH8 LYIHp8H(HHCXAl$$1LH` 9H߽LM+ IH5J1fDHL赳AE@LJ1ɺ# 1H5}J跬PfLYX1ɺ 1A$?H5LJ膬輣ff.AWfAVAUATMUHSLHdH%(H$1$$HDŽ$$$D$<ĺu8AH$dH34%(D H[]A\A]A^A_fD t_D$HWH-ILHEHD*H1ɺUIL>LH54I1qAZA[h$E1E1HHL$pH蓿ADžDD$pD$tEt"t.H5KHA3 @fD1H4HCXH0H@AD$Y@HZHD$HLLHD$1ɺE 1H5E>踗UfHSLHHdH%(HD$81D$D$HD$$D$,$L$DD$ t|HHt=HHHÅuTL=1ɺS 1H5=ӟ6HXLM1ɺ IH5l=1褟@Ht$8dH34%(uHH[]轖ff.fUSHHtAHuH[]H  H[]1 H[]fATUS"PLtsI1$DI$HtHÃ;t;A9l$LvHH@I$HH؃8uHxNu[1]A\H{7tA9l$Lw[]A\ff.@AWAVAUIATAUHSH8dH%(HD$(1u)HL$(dH3 %(D H8[]A\A]A^A_ HAąExL?Iv H5;1H\ u E[H讹5HZ I1HMHLH5>L% HEPHH8G HHKHH0 ADžH E\SH5b>L4& E1E11LHL.t $_HWL+K IH5h:1蠜rHpg IE1E11LHL述;<$@HLL9AI@4$EHL9!HsE1E11LLZuL91ɺ H59A@L91ɺ{ 1H5}9E1贛3L<1ɺq IH5G91AK@E?L 91ɺ 1H59?f.L81ɺ1H58H fE[@AE[@d1E1ALHLe $t T$+#HLE1HXI9f.H{prHCxAHXI9uIEHʴHL2HAWIa 1H57 AX1AYL7 H571L71ɺ1H57E1輙HHE1%LG IH5671nffIw1ɺ AL6H561L61ɺ H56 CUHSHH諧t7HC@Ht.Hx8HkhtH{@HH[] DH1[]Hs" uHf fDLG1 H5"6\H3 HH* f.SHH dH%(HD$1HD$VJHD$H9t HuPHt$HtHD$HL$dH3 %(u-H [HT$H5Hf.1׎HGX@ UHSHHH9t+HCHxHuHCHxuHH9u1H[]fHCHx裱Ly8 IH541HCH@H[]D1DUHHSHHU H߅uYHtYH+HH HLHEUIQ 1H5*4dH1[]#HuHVHKXHH[I11IH+]I,Aff.SHH`VH1[HfUHHSHdH%(HD$1HGPH$H8t@HH5HÅt`HL$dH3 %(H[]fDHLD4 IH531GDHȯH<$L ԪHHt谯IH: 1ULMDH52XZR(G\ u tfDUHHSHHHGPH8tH[]DH]H[]DUHH55SHH HTHIHI[111]fUHH55SHH H|THIHI[1ɺ1]ff.@USHHH;THE11I11HH5^5 H[]ff.fUSHHHSHE11I1HH5 5 H[]f.USHHHSHA1I11dHH54S H[]f.SH tHCP[fH HpHCP[fDATIUSH/H]H9t(Hf.HH谄HHL9u[L]A\fSHHH胄HwHkH_H[VfDSH#HChƀH{X*H[&fDAUATUSHHHLfTHFTIL$H3H3JH ~TIHHH=#EfHLCTAD$AD$ oMKToUAT$JŅH{HuEH[HL Mt I}h IAT1LDS@H5%A XZH[]A\A]@ID$IL$H3BH3JH t%@M1LZDH5@H[]A\A]@LH=Eff.ATUH-ASHAH9t)I @HH9tHsHL謇uH[]A\1H[]A\fDHtSHALAL9t8LLNHx\HHTL1L1H uHNH~H3HdH3xlH t HL9u1DSAUfATUHSH8dH%(HD$(1)$)D$D$ HooVIH=EL) $)T$$HHHtLhHHL贆HT$(dH3%(HH8[]A\A]f.H=EHHHtIu1LCH5>D1@Ht)E1ۅtHH|HHtԀKILC11H5>1聎 @Et<$tHUH5S>MAUL/Bg114Y^hH8ooOL|AdH%(HD$(1L eAD$ )$)L$M9tjIQ0MA0L9tUHfHBHHwH3H3pH u1HOHwH3HH3pH uH@HHT$(dH3%(uH8HL9uM M9u1评ff.@H8ooOLAdH%(HD$(1L AD$ )$)L$M9trIQ0MA0L9t]HfHBHHwH3H3pH u9HOHwH3HH3pH u$HHT$(dH3%(u!H8HL9uM M9u1SHHtHt H{Ht[fDH{tHsHH=EH9t&H=EHsTFH~H[DHsHH=E ff.HH=qAWEH=KAH=/AzH=An4H%EHt8~HEHt"}HHEH1HfE@-Etf-ff.ATL%AU1SHAL9tH{H7HL9u[]A\fREDHH9tH;xu @H9xtHH9u1f.HH=A,u H@H=A HAUATUH-ASHHAH9toII"HSHLHPHH9tEI|$6HuѹL>H59H1[]A\A]fH[]A\A]UH$AHSHHAH9uKfDHH9t=H;kuHR@Ly>IH5r91kHHAHAH9uVfDHH9tHH;kuH@L=IH591 HH[]=DH[]ÐF<t$tH@fDƇH@pƇH@`ATLGUSHOHL9t;q{H=ELLL$L$AM1L 8H50܀IHrLrfDLrMLY6g~H=ELL$uH=ֶELL3L$AJM1L.7H570-i1ɺL$LH5 0LL$L\$LL$L\$L$q#wSHH0HtH@HHtHt HH[遳[ff.ESHt.HHtYuHu?H{HpT[1H=EHuL1ɺH55/01[@L1ɺH5/ HNEHt#HHHt$HH=)E\Hu1HATHfUSH0H=EdH%(HT$(1)$)D$D$ HHooPIHL) $)T$HHt~HtH@hH9tHu#HL$(dH3 %(Hu\H0[]A\HH{hH贔ATL65UI@1H5-}XZ1tSH1HǨHHtf[DH8L 5IH5]-1Q}1[ff.fSHHǨ1HuHt%HPHH9t;ZH-)HXHHI1t$I1H5&oXLZRM1HILHPLc`M$$M9ufH蘅H|$H苅U1H5ATIL'1nD$0Y^IHl$H$H|$\ HL$IHihHcHE8H%H9 L91(fDHg HHL9X IHcHsHF8H%H9t1ҹL'uH,$11H%H$H LL`kL $@LS)Lh'H51mL$M9fL|$0Lt$x-H~LFH3xL3@I LxPHxXMiE1HD$fH|$0E1E111LVH|$0E1E111HމD$@VH|$HLD$D1mH|$HHމD$\ m|$ D$`S<|$(D$dF<t$8|$ D$ht$<|$(D$XHH=ƼHDH߉D$l*LHD$pHIT$Lu(Ut$LH-^LyVL$@QH$Qt$`VL$PH5Q@P1lH@MHH5^IEHt$(褂HL$LHD$ HHE苂MH5v^IT$LDHL(Ht$0LVHL$0H5Q@UP1AWykH$HHt$PH0 LH$I HIT$@Ht$(L'LVH5AWUH-aP1t$xkH0D\$HH7EHDHT$ 蠁LLINjD$IE脁Ht$ IT$L{'@VLH5AWUH-P1jH D$`HHILEL\$ HLINjD$\HDHt$ IT$L!'@VLH5AWUH-*P1jH D$hHHWILELT$ 蜀H=LINjD$dHD耀Ht$ IT$L8@VLH5AWUH-P1iH D$lHHILEL\$ T$XLIDžHHDHt$ IT$LM&@VLH5AWUH-P1hH L$DHHqILELT$ t$@HSLIDžHD|Ht$ IT$LO@VLH5AWUP1hH H|$ZLZ|$@DT$HE+HIM$$L;d$xI\$L9tH5qAL)H5bAHAƉD$D D$IE8H$LHHHH L$ HC8T$8HHHH L$( ‰T$<u HDŽ$H$Hzu HDŽ$ID$HHD$PH$H$H$H$ID$HHHtDL}HHH^H߅$}HH&^$ID$Ƅ$`H$@o)$@oHAH)$PH9tEHJ0LJ0I9t)fDHAH>LFH38L3@I H L9uHHAH9uE1HD$E1DL$EtNDD$EuDLHDH51ALH5"AH߉D$D$D$$ȃHP|$@ t$D LH&)@+|H|$H|H1ɿHT$ I1LH5;RUAT-eD$@H pDH|$0LDH|$0DHHD$ϻIHD$HtLH'\$MLL\$H$L|$0Lt$xH} L;hhL3{HH$Hxh{S@PLL$1L!H594dH$_AXL9t&L;nufL9nH6L9uLzHL>"PLL$ H5f.HHozH1ɺt$I1LH5cAYAZH|$HD$HXhH9H$IH(L9*HXL,$H]HHyH1ɺAUI1L`H5cXLZ=I1HILHPc`HEL9uLHvH$H{hoyH@LPLL$+1H5bL$LkhAXAYM9LyH@LPLL$H561*bY^H$LL9I1HcfDL1ɺGH51aHxxHHmxSL}1PLL$1H5aA[[DL9aH'xH1t$I1LTH5E;aXZ@H$YHH$H$HHQhHPfD"L $L11E1E1H5`HD$fH|$Hl$H]hH3wH1ɿt$I1H5XLG`YH^DH|$HD$HhhHvH1ɺt$I1LH5_AYAZH|$1HLIHPH$e`I\fL $L11H5_H$fDH=AH-JH$H=AH$L$H;$t\H{usIIH51@_HC11H@HtHHL9uH$H-L$H;$tJf.H{guI@yIH51^HsLHL9uH$H=AL%AH$@L$ HAL57L9uaD1ɺaLL ^H{tHc1UIL1L]HXZL9HC@HLoo)$ )$0} ul@Ht$1LH\$LHIf9I1MLDLl$ HHH$HH{sHILP@!H5 1\AZA[fLsH1ɺt$I1LH5 \T_AXHtLhH$HAH$L9t&L;oufL9ovH?L9uHsH1ɿt$I1H5; L*\Y^H|$1HLIHPc`DL$DtT$@H HD$PH$H9WH$H9FLHn \HXrH1ɺt$I1LH5v l[]S_AXHtHhH$HH$L9t&H;ouIfH9o6H?L9uHqH1ɺt$I1H5 LZ_AXH|$1HLIHPc`HhqH1ɺt$I1LH5 |ZmRY^HtHhH$HH$IL9HZH9[H@H9hNHHL9uH*L,$I$L9L5Mf.IhLpIM1AWpH5 P1YA[A_HL9sHC11HIHtH@h@HLoo)$ )$0- eL1ɺmH5+ &YAH|$LoH@H5PLL$1L,XH$AYAZL9u9LxoHLPLL$H6L9tL9nuH$HHL$PH$H9uH$H H9$$ȃutHD|$XEtgDt$lEu]LHf.+fDH H$IeLHal$ltD\$XHED|$dt|$huLH'N|$ht|$dHf |$\t|$`uLHb|$`t|$\tLH\f.HH1HǨGHtHHfDHff.AWAVIAUIATIUSH8L$ H\$HdH%(HD$(18LL=HdLxHhI9u"}DIOhHHHH M?I9t]FHuֹL VH5)$V1HT$(dH3%(?H8[]A\A]A^A_Hl$H9tfDH}HmH9uLL{Ht$ML11cH5UD$ IHLt](Lt$I.LI9t$LIGHHmH9uLLHtJf.;fL1ɺRH5U11ML&1ɺpH5T1 Lf.1DfIHtHHL.j1f.AWIAVLrAUATUHSHH(L"ML]t9H{PH{LkPMLK`LE@fDLK`LE@LkPMt&I}HLLD$L $*KL $LD$LLHL(AŅuyM-1L+H5SH(D[]A\A]A^A_H~P1~t"LkPM]H{,@LkPLLH&AŅDmPEu H}XDu`AAuDA9tqsƃAƇH{hT$H4$oiH@LHt$I1VT$H5R~AUATAVsRH0ADvƃDL{PMtAHuXUTBA9Q#MAI9u9tH{hL$T$H4$hAUL$MLWE1QHt$1VT$ H5RAVP1QAƇH0Md fDE1MPMLK`LE@D]TE\fDHCPHxHk& D8@M61LH5Pj@MAH{hIET$H4$zgH@LjHt$IVT$RvAUATAV1H5~PHCPH0L]0HPPHM@LuHLm8D1H $DXPMHHtHLHT$qGHT$trH0BHSPLHT$FHT$HHHRHH{hHT$fAUHT$LI@1RH5O_AXMt}HCPLMtLLFt^LALkPLFIHMmHH{hfAV@H5CAUIL1&OY^H<$Ht|HCPLMt LSFt`LAH<$LkPEIHjMeHH{he4$LATI@1H5NXZI0HhL/H]L#H9HHLLM$$H9uAfD1L H5)$NHC`LpHL4H{PqMfAH{hIAƇET$H4$dH@L Ht$IVT$RAUATAV@AH xHH{hHDHHHL\$HT$HL$dHT$L%IH5C1RHL$Q@+MAYHCPAZL\$fHCPHxH#fDMML H5LM1L= H5LML H5|rLL $LH5TJLAVfAUATLUSHoOhHdH%(H$1HD$(ID$8H$HG`D$HHD$0HD$XD$hoGxHD$@HL$Ƅ$HD$H)$)$AEL9t9H@H{1Hw@HtH}LHAƅt>HL9uAH$dH3 %(Du=Hİ[]A\A]A^f.L1ɺ1H5 J8BAVLA1AU@I7 ATH5USJH=#EHtHEH=EHt#H5[H=E躺HEH=ЀEHt螺HEH-AL%AH]HL9t$fkHH谷HHL9uH=~AtUH=nA虿H=2A-H56AH=AJH=#AH='AEu5[]A\A]A^@L O H5I@Lpt\I]pImpH9tL%fDHH9tHsHHLuM1ɺl H5/*IL1ɺh H5Iff.@HHcHwHf.HGh HAWfAVAUATUHSHoMhHdH%(H$1HE`D$XH$D$hHD$`HD$xHD$pH)$)$$$oExHD$xHD$0Ƅ$Ƅ$H|$0)$)$HD$(L$8D$H芿HLPIH@LHD$HM:ML9IF HLMHD$ IhI9tHfHJHH;y@tHL9t*HHH9y@uHIIH;\$HIhI9uAHAt$HL$T$]HL t$$I1VHL$ H5QT$01R F4}EH P'}ELLIH|$ LIYHHH;\$GHL$I9Ll$`fHCHx@H6rHt]P@, LATL1H53)FXZHH;\$HC1LoA)$oXA)\$HCHp@?IHsHxh\HL1 PH51L|@EAYH}LAZHT$(%MoMwM9ULuMmM9HNj@du$?HHHDHfDHHH@ff.AUATUSHI@@4IhL#=9cEHuA@ cEHh^AąHHkHHp IHMHhHHǝ HnHHxEHRDpLHt$HH|$@lXZH[]A\A]DIHC1ɺ;LlH5LHH1+ǃ @Li+1H5_1j+H[]A\A]DAI@1ɺ5LH5LHH1 +ǃrf.L1ɺD1H51*H[]A\A]Ly1ɺALi1ɺG1H5*f.L0f.L1ɺN1H5BO*Xf.AVAUATIUHH52gSHH0dH%(HD$(1HD$HD$QHT$H5fHID$HxPHt$IHE11H1L*ÅXH5GHHÅHT$H5)HH;ID$HxPHt$~IHI$pH54HÅMl$XID$LLM$hHhX!Å\fH5HA$xI$xA$A$A$A$<t%HH5HÅzA$H5Ht*I$H5HÅmA$H5sHt*I$H5XH\Å`A$H5EHt*I$H5*HÅSA$H5HMt*I$H5HÅFA$H5QHt*I$H56HÅ9A$ H5Ht*I$H5HÅ,A$@H5Ht*I$H5ȷHÅA$H56HYt*I$H5H^ÅA$H5HHT$H5H;HT$ H5HID$&H@PHt$HxZHt$ I$ID$H@PHxYI$CL`HHHL4ATI6H51%_AXHL$(dH3 %(H0[]A\A]A^ÐID$HL`HHLIAT3뗐ID$HL`H_HL7IAT?fL1ɺ<1H5%Vf.ID$HHXH9L~SPLL$H511$Y^L`HHHLIATBDLA1ɺP1H5jw$fID$HL`H_HLIATIfID$HHXH/FLSPLL$ +ID$HL`HHLIATVID$HL`HHLIAT\ID$HL`HHLIATbID$HL`HqHLiIAThxID$HL`HAHL9IATnHID$HL`HHL IATtID$HL`HHLIATzID$HL`HHLIATID$HL`HHLyIATID$HHXHQHLISI1H51#"XZXHXHHHLIS0SHH dH%(HD$10 EXEt%7XEHT$dH3%(H [DHL$ LL$HߺLD$H50@WE{4WEtQT$ t!|$vWEWE@Ly1H5!@1RD@SHH?t [LO1H5 [ff.ATIH5+UHSHhLHPH1NHH5LH@HPH1ÅpH5L1Å3  @HH/H!H5L1ÅHH5L1ÅL1ɺ1H5FS"L1ɺ1H5"/[]A\LǼ11ɺH5[]A\fDHH5L1HÅfH5L1ÅL@1ɺ1H5ivBHH5L1Å~NfH5nL1Å'H5<L1iÅH5$L19ÅLh1ɺ1H5jf[]A\@HxH5:L1Å>fHH5 L1ÅfHH5L1xÅfL1ɺ1H5f.Li1ɺ1H5kf.L91ɺ1H5bo;f.L 1ɺ1H52? f.Lٹ1ɺ1H5f.L1ɺ1H5f.Ly1ɺ1H5{f.LI1ɺ1H5rKf.L1ɺ1H5BOf.H11?QEHff.@UHHSHHHH9HHC(HHHCHRbAHC rŅt3LK(1L@1ɺqH5wH[]1L'1ɺpH5R_H[]fD1L1gH5*H[]Ðff. AVfAULATIH5VUHSH0dH%(HD$(1LAEAE AE0HD$HD$HD$HD$ HT$H5lVL*HE\HxPHt$nIH2E11H1H`ÅHH5L@ÅHT$H5L貹ÅH\$H HAH޺LHH5xLKÅqHH5L+ÅHT$ H5CL-HE_H@PHt$ Hx LHHoH5L论PHT$H5LҸHEdHxPHt$IHH5ͨL[t HH5LaÅmH5L(t'HH5{L.ÅhH5kLt'HH5QLÅ\H5DL费t'HH5*L躶ÅPH5Lzt'HH5L耶ÅDH5L@t'HH5LFÅ8H5Lt'HH5L Å' H5L̸HELuXLHHXMtIMXHLÅ>@HhHLHL$UI;1H5tXZHL$(dH3 %(H0[]A\A]A^HELHhH~HL~IU8HELHhHPHLIUFgfLٲ1ɺA1H5Tf.HELHXH>L7SPLL$H511AXAYf.HELHhH蠷HLPIUZfHELHXHpHLISNzfHELHhH@HL(IUKWfHELHhHHLxIUU'fHhHLHLIU_E1HELHXH讶HLISbHhHL脶HLIUhHH5L萳Å@HELHhH*HLRIUpAHELHhHHLdIUwHELHhHεHL6IU}HELHhH蠵HLIUHELHhHrHLIUHELHhHDLWIU`HELHhHLVIU7L1ɺ1H5&HELHXH̴LkSPLL$ HELHhH衴LQIUSHH:K7t [L1H52[ff.SHH dH%(HD$1 GE{GEtHT$dH3%(u~H [ÐHL$ LL$HߺLD$H5{JE E[ 3EA\I9fDH,$H\$fHHE1ɺPL 1LH5AYAZSfDLy1ɺxH5~P@ML11CH5VH|$(HH]8JIL 1PHLPH51)XZf8L 1LpPHf>PA,ff.UHSHH tHHH[]fDH1[]AWAVAUATUSHdH%(H$1IL$PHtIIPMB uTLU11ۺwH5.H$dH3 %(H[]A\A]A^A_IPH1ɿL"HH5LJHpH{1IXZ~A`H$IIL@^IEu!LB HHH$Htkb %Ht$lLI~D$l!H $LIH51I1HHp{k HD$H-IM @^MuI0:I~17LIH5T1MI~T$HLT$I1H5R;A[XLٖ1ɺH511 I~$HLT$IRH511AYAZfI0II(MHH9INfHT$pH)$H H5)B0)$)$)$HDŽ$HB@HIP)$oIhoAxI8)L$pH)$HDo)$oYI@)$H)$HD)$o!)$oiH )$`HD$ HH$H +HH54HD$(HE`EfHXIPHL$HD$HHH5HH HL$PHD$H@HHKH@Hl$8ILl$@IHH\$HHLHDHD$0HL$XHHM/Hl$0Hf.HHuHLuMMuHl$8D}TI0I(I IH\$L6HLELD$HWLVQRPt$Ht$HLL$HLD$hHL$`HT$@H$t1H@Å\@I~Ht$1HL$H$OH$LI1RHt$VH5_AWHL$ QH N@I1Hf HD$ H%I1HHpf HD$(HLߒ1ɺ1H5HHLISH\$HHt$1Hl$8Ll$@H2HD$HHL|$0Hl$Ld$0Ll$8Ll$XHD$HhHtDDH]MMLIIt$H~HuHmHuHl$E`Ll$8Ld$0}TI0I(I IEIPH\$f.H}TI0HD$I(I H\$ILY1ɺ1H5a\L31ɺ1H5;i6H|$H53HAHD$P+Lݐ1ɺ1H5L1ɺ1H5HE H1ɺSLH5p1SLL$pH H|$H\L@1ɺ1H5HvCL1ɺ7H'H\$USHHHPDHEtLtTH[]@ǃHH{ H1ɿjI1H5L=eL^_uǃLHH{H1 Hl1UIL#1H5JxXZH[]H-bHPH H1ɺ_UILkH51(AYAZff.@AVAUATIUHH5SHHdH%(HD$1k1H5oH2HID$HHxPHrIHH5-HÅ01H5-HߍHID$HHxPHrHE11H1LwÅ=ADŽ$`H5H袒Mt$H5I~HI^XHH2HHLHDI^XSÅH5*HJ*I$HH5*HKÅ6A$HID$HHXHqE$HSLoH5P1C[1]GDID$HL`H%HLATI1H5XZHL$dH3 %(LH[]A\A]A^ID$HL`H近IٹLATPH5i11A\A]DH58H I$H5H蚎ÅI$ H5HyÅI$(H5HXÅ9I$0H5H7ÅHH5Hnt_ID$ H@PHxI$8HHH5{HpÅI$8H4$%w ÅH5KHImX4 fID$HL`H?HLIATHXHHHL ISNfDL1ɺ1H5f.HXHH贏HLISfDID$HL`HIٹLATPIbE111LLIÅ50fDI$`H5|H蹋ÅID$HL`HHLfIATLq1ɺ1H5yfID$HL`H菎HLIATeLXoH ID$HL`HJHL IAT ID$HL`HHLIAT L1ɺ,1H5ID$HL`HčHLIAT ID$HL`H蔍HLIATjID$ H@PHx~I$@HHH5H ÅI$@H4$s ÅID$HL`HL!QIATID$HL`HڌLARIATID$HHXH讌LASISID$HL`H~LVIATYID$HL`HSAPIL7AT-ID$HHXH'LXWISfff.AUATUSH8dH%(HD$(1HHxHIHH5LHPH1ÅtpHH54LH@HPH1Åtr`H@^HL$(dH3 %(H8[]A\A]DL1ɺ@1H5DL1ɺA1H5DL1ɺ>1H51bH5L1Å1LN1ɺD1H5V!HH5hL1ёÅLHÅHH5FL1蚑Å H H59L1xÅH(H5L1VÅH0H5L14ÅH8Ht8I(L~o ÅLH5ĺL1ÅH@HH(H6o ÅtHH5L1訐ÅL׃1ɺZ1H5߸ L1ɺL1H5|f.Ly1ɺG1H5Lf.LI1ɺJ1H5Qf.L1ɺM1H5!OL1ɺN1H5)L͂1ɺO1H5շL1ɺS1H5zL1ɺY1H5TL[1ɺT1H5c.ATIH5UHSHLH@HPH1ŽtvHH5LHPH1袎ÅHt"wqH5 L1vÅLHÅ[]A\L11ɺH5[]A\fDH}/HLSI11H5CqXZ[]A\1L1ɺH5?[]A\Lـ1ɺ$1H5(f.L1ɺ1H5f.AVAUATIUHH5 SH?O1H5HHID$HEHxPHdIHeH5ptHÅ1H5UtHHID$H"HxPHVdIH:H5H蛄tGI$HH5H蠁0A$HPuID$HhX;@HL5Å+LL>ÅFLL<ÅID$HWuQLGDID$HL`HEHLuATIH51Y^[]A\A]A^ID$HL`HIٹLATP1H51_AX[]A\A]A^DID$HHXH觃E$HSLH5N1P1wXZZID$HL`H_HLgIATHXHH4HLIS6fDHXHHHLTISfDID$HL`HςIٹLhATPLY}1ɺ1H5atf.L)}1ɺ1H51_Df.L|1ɺ1H5/f.ATIHUS;LHHH/LHC(H4(AHHC@@HC 6ŅLK(L511EH5SHrHHtrHqeHC HLHC(H'AHC 16ŅLK(11LSH5ڰ []EA\@L1I11H5[]A\1Lo{1ɺDH5y[]A\1LG{1ɺRH5Q[]A\ATIUSHH+H9u %@HHSHC HHPhHEI9u[]A\fAUATUHSLH{HIHzHI9tDH{zHL9uLwRHt=Hp{Hc{HL H M,$LI9uefH3{HtHVzHH+1[L]A\H5A]:f.It L90t0I|$ yHHID$ HRRHH IMLMI9u@H[]A\A]DHczIHHI9u#LpyHQHL9tL9kuAVI1AUATUS螦H5HX HE1L-!@AH[HtO;uVHkLHH51HtH5HuIH[AHu[D]A\A]A^ML11H5ZsH5THqu AP@H5=HQuA0@E1[]DA\A]A^ÐH#1MULʽ1ɿH5'XZM E1LH5SHGxHt"HH'yHtH[yf[fU1ҾSHH{HHHHt#HÅtXH[]fH;8 HHHNHH NH1L¼H5H[]Lv1ɺ1H5u1UL1ۺH5J,USHHRH1Ht$H{pHNHE8HkhHk`HxH[]ff.fATfLUHSH`H6 dH%(HD$X1H6 D$H\$ HT$(Hd H<$HT$0H'HD$ HT$8H5. HD$PHT$@H HT$H(fH@8HLHIMHHt1HHu1HL$XdH3 %(H`[]A\fDIHLR tLH[ tLH$tLH5 Åt&LHtLH13tLt1ɺ1H5Nff.ATIUSHH+H9u %@HHLHCHHPpHEI9u[]A\fATIUSHdH%(H$1HHupI<$HsA I$HI<$H I$HH$dH3%(HĐ[]A\Dk18HL PHLPHH5CP1H fL|H5^OfL$H5.d@UHSHHH?L1ɺIH51H;H H衧t H[]@I1LH5@H[]ff.AUATIUSHH>t}11lHHtlI$M$I9u AHL9t9HSHL~uLq1ɺ1H5HH[]A\A]ÐHL1H5uDAUATUSHH.1ҾHǗAąE1D12 1ҾH貞HHX L-H|/1H…u!HLHHNH9t2IL11[H5E111 HkHŅH[H;HkEtHHS1HYDG fDLp1ɺ7H51UH[]A\A]H[]A\A]fD1LǶ1HH5H[]A\A]DLK1cLH5vH[]A\A]L1AH5B:ff.@ATUS@H1Ҿv萕1ҾyH߉Pې1ҾxH߉ʐ1ҾwHAHDPDHH]Ņ1ҾtH1ҾuH߉T躊HTHH@_Ņ[]A\f.L1ɺ1H5-zH1H5^HE111H5][]A\@1L1ɺH5'[]A\1Lm1ɺH5[]A\Lm1ɺ1H5}f.L1ɺ1H5Mf.AV1ҾgAUATUSHH@dH%(HD$81蕓D1ҾkHɎ( 2 g2 4- 1ҾeH蓎0x, 1ҾlH1ҾH 1ҾnH:HpH諿11. 1Ҿ|HÒ<, 1ҾjH角1ҾhHAEHHth1EH@'1ҾoHh1ҾqHbH(L` 1Mt~L5dDMd$MtcA<$Ml$LL踽H5L衽tH57L莽Md$Muf,1A1LijH5f,K0 HĿrHHsH1ҾiHVH]Hh E1HtaL-%5ML611gH5zHmHt#}uH}THmA HuDlDH\$|1eH|$HHD$11IٺD$(LH5J8~HD$8dH3%(UH@[]A\A]A^DLѱ1ɺ71H5fH5PL豻uEDHun1ML81ɿH5>XZfDH5`LYt5H5x]LFur ]f. fD;fDH=i1ҾfH)@H5QLtH5eL论uJ@̀@1ɺaE1L LH50fH5 LQt%H5!L>u"R@DH5L u ML(11SH5Lm0H5x5AW AVAUIATUSHHrHtELpHMt9A04HLrLuMDH[]A\A]A^A_fM&1A<$@IL8 ÅInHAH] H|L} H=Lu@u @IH{tAH[HuE1D LH=KHmHjEtLLEÅMvMI~ ufE1M01LH5Le1ɺa1H51fL:H5gLee1ɺf1H5ICILgÅt=ADž0M[1L­H5ILd1ɺP1H5Ѹ#ff.ATL LUHS>HuH#LHEH@HIپH=E1{LaxvH}IHtOHH=xEsmID$HtaHL<;uuID$H[]A\DL11H5з"[]A\1Lc1ɺH5[]A\It$H#Åt []A\ÐLyc1ɺ1H5]Vf.S1Ҁ@Hu!1]HHtI[H5TÅu1Lc1ɺH5=[fLM11ۺH5 AUL ATUSHH I9t[IfDHL9tHHs1LŅu1Lcb1ɺH5IH[]A\A]fDH[]A\A]fDUSHHt>Hu9LR1ɺ>1H5H-1HH[]HHEH}HpHHHH3 }tC H=ӶHuLB1ɺO1H5^zIL11JH521LDL1ɺC1H5W!fAWHAVAUATUSH8H<$Ht$dH4%(Ht$(1HD$Hp8gH|$H5sP1Ll$ Ld$込HHcfH LLͰHL|$E7EtAH@IE7EtIDA uA#tHt;uWAt <#Lu/#t#HuH<$LHd@H<$LHILL$Lթ11rH5H|$H1u&HH\$(dH3%(H8[]A\A]A^A_Lp_1ɺ1H5TLM_1ɺ_1H511 1ۋ8aHb1PLL$1LUH5FXZRzf.AW1Ҿ}AVAUATUSHHzH1ɺHHHH1Ҿ~HH߃ 1҈H߃ 1҈资H߃ 1҈芄1ҾH߉L%z1ҾHHGzD(HEL5'EIE1(蛲IHDH@IIE/EA%uAGH5#H'/H5HH5HH1qHHHt 8yIL11]H5sŷ@1ҾH߽:w "LIU1ɺ1H5-H$ dH3 %(Hĸ []A\A]LɡH5ը11#뢐MH5UHuǃXjfDL1ɺ1H5uǶL11H5T覶1L š1LH5'~Hǃ\)fH( @"Ƅ$HH1H=D޹L%H5rCH=D¯L-[IH{LH=DdHHtT1H cDH=wD買uH5VDLuLH-1D购tzfDL蠭(8<=5DH H'HDHL DPHPLH51RH HL$HL5LyR1ɺ1H5]说+f.HI1ɿhH5*Lנ1sY^HT$HƿάHf.LH51 L$H= 1ҾHmHHL% fHH?DL1ɺ1H5%wfL%LEIL11OH59@HT$Hƿ螫D$(%=`L1ɺ1LH5ڲLs1ɺH5i1蹲HODL1ɺ1H55臲L1ɺ1L˝H5Z8>L1ɺIH5ڣ1*LÝ1ɺK1ҾHkL$H˥HL1蠵LH|ILV11H5J蜱ƃ@"\HHH|H8H=ADH H3HDHL $DPHPLH51RH L$1ҾHjHHUH=^H5_fH)$ $L$HHНD$LPD$PD$%PD$,PD$3PD$:PD$APD$HPD$OPD$VPD$]PD$dPD$kPDL$r1DD$qHpxzLH IL11H5yD DΣH1ATI1LH5b贯XZLVM1ɺ1H5:茯`¦fU1ҾSHHsuHH[]If1ҾHqsH߉BuVtL1H51LL1ɺpH5H1[]@HtHtJUHSHHH9u )HH9t H{JtH[]H1[]ff.@AVAUATUSH`dH%(HD$X1+I1H LH#H$H61ҾHgH6Hx 1 HD$H31ҾHfHt4Hx 1Ҿ HcչLHԺHHLcLJHH&UHcHH1Ҿ"DuHPqMcuH1HJH1Ҿ$AnHqLc9HJHHH$UHcHH1Ҿ&DmHpf1Ҿ(HpLDHH1Ҿ.Hypr 1Ҿ/Hcp| HHHH+LԙH5֫1HL$XdH3 %(H`[]A\A]A^fDH4JHAnLcLH5SLcK,Ld$HEHHPI9uLH1ɺ1H5 1*fDLq1ɺ1H5תHUL|H5O親t[JHyDuMcmfLDH5^ f HzIcHHAfD HHIcHHDEkLAnH5xLcǩrfLH5G螩IfLٗE1H5kfDL G1ɺ1H5Am;Lcnff.AULopATUSHH_pL9tUI-H}LԘt0H{@Ht L还tHL9t#Hk8LH褘uHH[]A\A]fH1H[]A\A]AULopATUSHH_pI9tUIHL9tHHsHHLSŅu1L F1ɺFH5BH[]A\A]DH[]A\A]ff.AWAVAUATIUSHH/HGHHHF8H9t"L~(IH{(LAŅtHH9uLHA]?HAv]1ML:H5"yXID$ LZPhHD[]A\A]A^A_f.SH H=]藝H8HHDHQ H1ҾBk+ [ff.fSH   1[ff.@USHH=ٚHHt!HH@1HW9xUH=ĜHtHƹH=t H[]@H@H[]1L1H5H[]ÐSHH{HtH;HtHGHtH[Ηff.SG茝HHH/etc/lvmƃHHH@H=HHH=@jHCHH=TLHGHHH H<HLtHH@H5;H|L-B1ɺRH5eDH1fH[ÐLA1ɺ9H5ڕ1LA1ɺ<H5 LA1ɺHH5|@HHH9HHSLRA1ɺXH53芣%D1L'A1ɺ4H5 _H[f.L@1ɺKH5ڔ1@L@1ɺBH5 @L@1ɺUH5|@L@1ɺNH5b蹢T@ATUSH[ t?AHHtHPHǃ1HŅtD []A\@L?1ɺ\1H5Փ'DAW11LgAVlH5AUATUHSHE Ho11HVHF9HHH}pjHHt豓HDžH L HL9u fDHHHL9uH?IHLMtMd$LMtMmHHDž0HDž8QÅWLMtLL<HMt,LHSHSHHX@Mt,LHSHrHHW_HLHÅR@tH5ܵHÅwHÅLHHHMtHL;HHWÅHÅ[1Ҿ!HjH@"H HHHÅH;HÅMHIÅHÅHÅHÅHGHtHÅH(ÅNDLa<1ɺ|H5B虞@L9<1ɺ1H5oH[]A\A]A^A_fDL<1ɺH5115L;1ɺ1H5DL;1ɺL;1ɺ1H5םcL{;1ɺ1H5_豝=LU;1ɺ1H59苝L/;1ɺ1H5eL ;1ɺ1H5?L:1ɺ1H5ǎL:1ɺ1H5L:1ɺ1H5{͜YLq:1ɺ1H5U觜3LK:1ɺ1H5/聜 L%:1ɺ1H5 [L91ɺ1H55HhLA1ɺAH51HL91ɺ1H5֛bLz91ɺ1H5^谛I I~pI I  I [/聉EhI@HHߺHNLFA@H=YIHH=ȢIFHH=IGHL<LLIL5A@tH5֬LLILIH0LhXL(1Ҿ!LbI@"H"IHy1ҾLZL L2L! LԽLD kLLLIG u1H與AG51D$ EtLpAIGAo(Ao8AoHAoXAohAAoxAAoAAAAA H0LH5L1H5xʔD1ćHL}1H51H[]A\A]A^ÐHcUtLuH5@ LuȃLHHHcTuH[]A\A]A^Ð9u@uA $*W+/XfDHAufI9D$3CfDAA\D$ 1T/HAHEft1H;f.HIt$H{HsH;HaIIHAEA9$u(LHLHuMmMd$MtMuHS1M LHzD$ dD$ tC1H;Uf}0ft1H;UHffuHcEE1L!1ɺH5h踃1AWIAVIAUIATIULSHIp(HHE1ҋEC(AEtuHE(HtlH{ E!} HGt1)HCMI|$LcMtI_HH[]A\A]A^A_DEuQ H AHcH>L(HC H3A}/,fDA}xуI}HLHHCHC MCH[Jf.T$ I}H{ T$ fH{ HEE!HHH HDHGH{ E!EGDH{ M HcEHG EoH{ E!tpT$ I}1UH{ T$ Hj@HC 1)Ly11ۺH5:.DI\$fDHcE T$ I}1UH{ M HT$ 3T$ I}1UH{ T$ fDT$ I}1H{ T$ Lx1H5<茀Lx1ۺH5 \PAUfAATIUSHH8dH%(HD$(1H<$H~ HZ)D$HD$HD$ HD$ &H{ %HHt$H H$EtxHHD$HML|x1P1H5<XZH<$Ht Ht$謰H{ q%HD$(dH3%(H8[]A\A]fHtkHD$HML1PfDLwH5H$HEtH,fDHvfHdH%(HD$1HL$H^t$HT$dH3%(u4H1L1ɺ H5W~uff.I1@HHHc:HL tNtJ f.Et+DHHtDȃA ufø1fDSH:H耱HHCHt[D1LvH5$t}1[AHH1EDH A f AAt HfD1L;vH5|1HfDAWAVAUATUH-SHHc_(H4$dH%(H$1H HѲHD~XHBIՋP tII tvH L%@D$ HLQ0ft1f;P@lj|$ @0uM@H$dH34%(H[]A\A]A^A_DHPu@L@AWAAML H{ EM(L o<1ɃH5B1E1rC(fDML@LH4$H4$A EMLoXH5ѧ<HAt$1Ƀ1 rA[[>@ H{ F TfEL fDI(1M9LA#ADHEH *IHEM3Lm<1ɃH{ L hHLEELoH5Ȧ<H11AVqXLZ1ɺIH51E1pH{ HL LDELinH5P<H11AVpAYAZL31ɺFf.EMLmaH5<11E1=prM L9N@1LHfD H{ HL LDELmH5h<H11AVo_AXfEL OEH5#L GLm<H11AVNoY^AWAVAUATUSH(Ld$`D$ MtNH<$MMHHIHLMMATH|$HH~^_I|$ t$Md$MuŋD$ H([]A\A]A^A_IcD$(H5@HHD!uHًH!%tDHQHDʉ@HHH)HL$HL$`HMLAt$HL$ HTH|$I)MHZY=fD$ 'AWIcE1AVIAUIHATHE1U1SH@HH8H|$HT$ HL$(HD$AD;kcAFt C Pt C BAN}H=bHcH>f.S  Avf9s"tC0ft f9X Mf.LD$HL$(LD\$HT$ H|$/D\$HIucLk1QH5^lH8L[]A\A]A^A_@AVf9S"rEtC0ftf9s3Mo{}H|$ILLLHLEHHPH{냐AVf9S"uIVHtX*uC uÃufDAVf9S"dH|$ELLL~ LwLj1H5KkNfDAWHAVAUIATUSHHRLcg(dH%(H$1D$B KL5K@HL { @ftHBHtZB tSHH5HL$_`HL$HHI}IL1H ^HYH$dH3 %(Hĸ[]A\A]A^A_DkuL|$ AHپLŅIEh@@t {"Ht$Ņ[IEhƄ$1@tKKHMd@Mt9L\9D$}+HT$H$LIE$hfD@HOHH„ L$H5(L̟QI}LP1RHVXH HBB KH5A@Ht @ftHBHnB cI}1H}7XBfHD$H ~H~&Li1ɺ71H5Ohf.L 0~LM@LfDL1ɺ51H5GhfI}HHQHL$HHHOI}IHLhHY1IWI}HC_ff.Hc1HtHAWAAVIAUATAUSH`HHtkHx(HHAu`H{ ڛIHDxMtH{L IEHt8LmDeHHHH[]A\A]A^A_AD$w@LKH5ffDH1v@Lf1uH5Lff.Lf1{H5lff.AVAUIATUSHHdH%(H$1HŋtePv]Hf@E1L Le1H5eH$dH3 %(D]HĠ[]A\A]A^ÐHHLuHDIvH!^AąC%=t7MN1LH5_eAFgfH}H贷HC0AFIHt AM6IFIE)@MN1ɺLH5Adfk[8XMNH pzHALVH5ZA9HDHE1PH7P1RdAFH [ff.@AUATUSHdH%(H$1HË)HkHuHLd$L\AŃbD$(%=HLKH$H9C}LM1Ld1ɺH5Xc{WLMH 7yHy@LyUH5!A9HDHDPH6P1RQcH D1LcH5֘+c1H$dH3 %(Hĸ[]A\A]ÐHI @LcL H51b1DLM1LycH5Pb#Y8EULMLb11H5XbHD$H9CtHD$@H9EehYHtgSHu?H@Ht>HxHt5u,L1ɺH5xa vH[gff.@USHHHt$HHt9(t H[Hu1HH[]f.AUIATAU1SHHHu %@HHHtD9 t#HCHHuH1H[]A\A]HCHt'HEIHCHH[]A\A]fDIAUIHATIUSH4Ht_HX HHtHH[]A\A]D8tI|$8ܔHHE Ht$L`L(HH[]A\A]1LEa1eH5`fDAWAVMAUATIULSHH$H|$HL$HD$dH%(H$1StlPvdH@E1L L`1H5r_H$dH3 %(DFHĸ[]A\A]A^A_fDAD$`tH$H$LHWIHHt$HLLE1O H$uAD$`H|$DK,7LϦLt$A֋$HA9$LE1BuH1ɺDt$I1H5 L`V^Y^LlPL:VIHE11MTLK/L)fDLtHHމkNHcЅ{T8tԃ tQLH:HtL8HbsHDE1otHIH9UPLOH5(1Sz]H LO1E1L_H5B]DIM9 LAD$`QAoAoOLl$ AoW Ao_0Aog@A/)D$ AooPAow`)L$0Aop)T$@)\$P)d$`)l$p)$)$@9OIUH01!fD@{t tHj@t HDN tHLD AŅLsH1ɿt$I1L%^6H5ϑ$\_AXH|$DK7LϦLt$A֋$HމA9$PD$Ao$ILH|$t2AŅu2LI1ɺO1H5/[&uAŅt/AH$K 7HLlL1ɺR1H5ΐ[1MRff.fATUHSHdH%(H$1HD$mHT$Ht$HIXH|$HMd$It$HHE11ɺjHjjjjLD$pjH0AD$H$dH3 %('Hİ[]A\fL1ɺgH51 Z1|cID$HtzH ÅIt$GfDI|$ft"ID$]@OfDLI1ɺH5,YL!1ɺq1H5WYfI|$bL11ID$vH5ǎYRPfATA1HUHDSHdH%(H$1+HH'HH?QuJEO8AAH$dH3 %(HHĠ[]A\fD1ɿ1IL"H5LXHDuILH5ˍX]fK}IH mH4HDHLIPH*H5tP1RWH H1DLH1H54WNf.HHPH@HfDHcE1H HK@HHff.@UHcE1SHHdH%(H$1HH@HHHHЋHHHH$dH3 %(u HĘ[]MAWE1AVL5@AUIATIUHcSH\HLHHdH%(H$1IL{t'M1LXH5NjVs I$L#tOHDHI1AV @t'H$dH3 %(u}HĘ[]A\A]A^A_ft[1LAVHTHIAV @ut1LAVLLDAFLL{fAFpLfAWAVIAUATUSH(HL"H|$HT$HD$MMl$I4$HEHtdI|$HHHL$Lx H Mt9A?u#Iw<@uFHt H'uwMMufDMMdLH|$HHt(Ht#HKHPH9@@t o@CH([]A\A]A^A_fDI4$H|$IH^I\$HuAoH{ t"IH3HLC t;L@ LM3LcuH3H=ufDM H=4L€uH3 H=ٗ€t\LH=€mL H=L€tLH=Uk€0L fDHHQHuHP HQ IGHH@HCIGHXfDIHH@ID$IL`IT$HH2LLLJt0MI1LIItXLIɅuML$LHH2I_HC(M&ID$KHJHHHH9K@gff.@AWAVAUAATIUHSLH(dH%(HD$1HGH$Ht$HD$HsH5HIKH$H1ML*1ɺ|H5QAD$BbH}E|AEIALd0fLH5?HHL9tMH}H3QHuL LZ1HE1H5nPL9ufH<$HtH`@H;8t HL$dH3 %(DH([]A\A]A^A_ME1LH5O-H@L5͆HH$fDH $H=[RIAD$H $gH=+VnIH}EHH5?AŅA@L1ɺ1H5ׄE1$OE8CA>MH dH+HDHE1PHvL@PH5x1RxNH ~@M1LH5AN,EAWAVAUIATUSH6IH7H@AE1E1 DHPAAhu-AEtA tLLLLHt MILDuA}M&tHL[]A\A]A^A_HHtzIEI~H0,HHI}1HLOt HC롹LMX|H5oMLE1H gLW1rH53MLE13LLW1\H5L LWwH5LdAVAUATAUSHdH%(HD$1AD$HH>I/HJBHHubIIDHLHcH$HDcHL$dH3 %(HH[]A\A]A^fDILfW11۹H5KDL411ۺH5jK{DH?1ۺB4H܂H51PL LwV1pKY^/fILDHH TH$HuRI}(HH$HD`I}H~IH4$HCHH$BD9H?HLKV4N 1H5OJXZ^L91ɺH5qJ2L1ɺH5MJL1H5$JZAHfATIUHSH} t []A\fI$LE1HVH=ExMuLH=EHE HtuHLÅI$HH s@LM11L1U H5~.I[]A\LAU1 H5~HUHuH/?LsL H5i~ 1HH} XZHE ff.@ATIUSH~ HCLUt%H5}11@H[]A\fI$HtyttH8HC I$IH{ L[]A\@ŅRLr1ɺ1H5X}GcLeL48tgHs Hs덐I$Ht)]LSf.LeL8uDLSfHt~uHHt1Ð[ff.AUATIUHSHHdH%(H$1HcHE1AHH@HHHЋHLHHMHEtMu(H$dH3 %(Hu!HĘ[]A\A]@At$Hd=@AWLcHAVIAUATIUH-@SKHHHdH%(H$1Ll$E1HپLD$ 臷{ t'M1L3SH5:{Es I$LKtnH1HE @u H]D$ tMu+H$dH3 %(Hu}HĨ[]A\A]A^A_AvLf.H1HE @uHUt LLHI$LHsLLH`;ff.Hoff.@AWLcHAVIAUIATUH-p@SKHHHdH%(H$1Ld$ E1HپLD$ { t'M)1LQH5yCKHD s ILKtlH1HE @uH]fDD$ tMt AvL/H$dH3 %(HHĨ[]A\A]A^A_H1HE @uHUt LLHIL,H|@M+1LPH5xB @LLH8 :ff.ATHIUSHHt@LHpLHHHu0HHXIHSLHHmHtxLHHH t`HtHH@LH-HHyIPH="D1EZYxuH{H5 D[]A\u1H@L gWLHpyH=DaEyLO1h H5)wyA+LO1` H5vLA[1]A\DLVL$U1ҾSHH7Htb1ҾHHHtKHsIHxHH= D1Dx/H{HH5D[]tfH-PV1LNy H5,v|@H1[]AWLcHAVIAUATIUH-`@SKHHHdH%(H$1Ll$E1HپLD$ ױ{t'MA1L3NH5u?s I$LtzK1HHE @tMD$ tMu0H$dH3 %(HĨ[]A\A]A^A_DAvLft[LLUfDKHHU @ut'LLUI$LD`DE]K36AWLcHAVIAUATIUH-@SKHHHdH%(H$1Ll$E1HپLD$ W{t'MW1LLH5 tZ>s I$LfKtvH1HE @tMD$ tMu0H$dH3 %(HHĨ[]A\A]A^A_@AvLft[LLUHcDH1HE @ut*LLUHcI$LHcafDHcUfHc]J4fAWLcHAVIAUATIUH-`@SKHHHdH%(H$1Ll$E1HپLD$ ׮{t'Mm1LsKH5r<s I$LKt~HfHE @t[D$ tMu.H$dH3%(HĨ[]A\A]A^A_DAvLD$ D$ fDtkLLUHfHE @ut(LLUI$L_f.EI$L[;fDE+3AWLcHAVIAUATIUH-@SKHHHdH%(H$1Ll$pE1HپLD$ 7{t'M1L=H5p:;s I$LFtzK1HHE @tMD$ tMu0H$dH3 %(HĨ[]A\A]A^A_DAvLtft[LLUfDKHHU @ut'LLUI$L`DE]K1AWAVAUATUHSHWdH%(H$1t GH]HEH6 HH9uH $Ƅ$EHUAEHHL$IL5@IfDEL LHH5o<1]9E1H[HH{ uHLHASMLL^_tHcC(HHAD!uLH!%tDHQHDL@HL)2H!%tAM HDHrHD։@LHHsI)L8ZYH[HEEu1E1H$dH3 %(0H[]A\A]A^A_ÃE1ҾH7¸tH]럿<INH H0@LYHu(HL}tNHPI9E1LHپWHEH u賧HEHǀ ELGFH5l97ELEH5l7E@.AUIATA8UHSHH?\kHtwH1ҾHH(HLhD`C ЈCu%H=H}HAgHD[]A\A]fK1LE1ɺH5kE1<6HD[]A\A]ff.ATUHSHH}LE8H$HHuOH}(AjHHHA1HHHD[]A\H¾HpAąuLE1H5jE5HL9E1E1H5j5D[]A\fLY4E1于H5j4HD[]A\ff.AWAVAULcHATL%~@MUHSK\HLHH$Lt$dH%(H$1[E1HپLD$ "Cs HLUuqH$DHBIHtZH1LLHx貳D$ t H$HH$dH3 %(LDHĨ[]A\A]A^A_ÐKDHIAD$ @HIt$IHH1HHGIG HHHxLLHf.pHCM1LzCH5h 3@E1ML$LC1H5wh2fLE1cL^11H5Dh2)f.AUATUSHHHHHH9tVHAE1 HH%HHޅHEDHH9uHD[]A\A]fHA[D]A\A]ff.SHD^HcHtVH@BvDǘDIL}BH5LgPHD1h@B 1Ƀ{1XZH[@@BH[fDSHnbHt HH@[ff.HG@9tHxH9HGHHuH@ ff.AUATE1USH_HD9tZHpHXIHGHHuH?(IaHt>(Lh H@H@L`HH[]A\A]ÐH[]A\A]1L1ɺ[H5m{?01ff.HG HGHuHHPHufHGHuHHPHuH f9s H@HufS`HHtHAH[@Lz 1H5zt/fUSHHt1HHq`HtLHXHHH[]Ð1L1ɺ&H5kz/H1[]fDL1ɺ)H58z.1ff.fUSHHt1HH_HtLHXHH蝤H[]Ð1L71ɺ&H5yo.H1[]fDL 1ɺ)H5yA.1ff.fAUIATIUSHHH+H9u:HEHI9t'HHsL=%uHHHEI9uH[]A\A]f.UHSHH?HH9u fDHأHHH9uH[]fDATUSHH9t8HIHH9t HsL$u[]A\fD[1]A\ÐATUSHtCHIHHH¸t []A\HH[L]A\vfD1L1ɺAH5x,[1]A\AVAUATUSHtHIIIH9uT@HL9tHHSLLAŅuL1ɺT1H5wJ,[]A\A]A^[]A\A]A^L1ɺP1H5[w1+ff.AVIAUIATIHUSsI]I9u`HL9tPHsL|_LLHnŅu1L?1ɺsH5vw+[]A\A]A^@[]A\A]A^AUATUSHHH9tJHIIHH9t0HsLtMtHSIUH[]A\A]1H[]A\A]ATIUHS L9u/H]H9u[]A\@HH9tHsLu[1]A\fAWAVAUATIUHHS1H(HT$LHD$茡M<$D$M9tI_M?HM9uD$v HD$HHsH#[HD$HtvHD$M<$M9tPH1fMoLHLIH$L9l$tLt$Ht$HLL$M?M9uHD$H([]A\A]A^A_ùLtH5ta)ff.@AWIHAVIAUIATUSH(Ht$L$TLIYHD$Hu_+f.L)LHpHZHHLH#Ht$LHSD$uFIA}LLJ, HuH\$HHHyfLLLHtfLt1H5s,(Ht$LOYHD$HD$H([]A\A]A^A_fL1ɺH58s'볹LksH5s'f.fDfDSHGH1HHH K0[fSH80HI1P-1L%sH56s'XZ[AVAULo ATUSHo H]I9t2IIDH}1ALIHHHM9u[]A\A]A^ATL%g UHSHfHE LHPH t[]A\fAWAVAUATUSH8HD$pHD$dH%(HD$(1DO0RHI)HAH I LcMHD$LD$u!HJDHtD9-FD8Lc(LtI,$HHD$I|$HLd$ HEeHDfHL$E(HEE8EEHBHM@HL$U,1ELu0HM8fU(HD$ H{ LtHL$(dH3 %(H8[]A\A]A^A_Ls11H5q$1Lq1ɿH5p$1DH;D$HL$Ht$HHH9H)Hc D1HHHtHH)LdI9HULd$ 1Lq1ɿATLL$ H5Tp:$XZI9Hl$5DH[(HTHH 1Pt$ LL$ H5o1Lp#Y1^QLp1ɺPH5o1Ut$0LL$0#H -HcDHL6qH5oP1jUUt$@LL$@X#H01HLp11ATH5@oUt$0LL$0#H Ld$IfSHw H_G0tH{h蘘C<[fH{x[醘fDUHSHHq8u9A0u3I4ulHk HH{HHH@H[]@HsD 1Lp_1H5tnU"EXZH[]HD s1LpffDUSHHI4uDC0u.Hk H:H{HHH蚗H[]fDHCh<fDHsD 1LhpH5m!XZH[]ff.USHHHo(H}t*HzH{ uAHH[]_1ɿLp_H53m!H{ ptH=AmHH[]fAWMAVAUMATAUSHH(H|$aHD$HHDHcHH L4<1Ht$[HH9D$I)LH AE1Hu&=DHIL9HHzDKt=L)B<0HE}uDAtA tHL$LEULko*Q1H5k1XZH|$H(1[]A\A]A^A_LL$1Ln1ɺH5kzH|$1H([]A\A]A^A_AfDAE)ELn1ɺ31H57kH\$H|$HH 貔HD$`HCH([]A\A]A^A_DUL8n&Q1Lk1ɺH5jH(1[]A\A]A^A_HDH9-DH;D$HL$H H9H)Hc D1HHHtHH)L|I9HzU1H5.jSLL$Lk1Y^H9HkH1ɺt$D1LlH5iH|$ AY1AZ,f.Lqm1ɺ51H5ioRPL"j1SLL$H5^i?H|$ U_1AXQLj1ɺPH5)i1USLL$(H Hc-DHLj H5hP1jUUSLL$8H0H|$1;HLi11AWH5hUSLL$(LxH DnfAWE1@AVAUIATIUSHdH%(H$1HHHI|$ HztpL{HLt(@fDxHw>AIl$(HI HHH賑M9tIIwH{H;s u1AfDH$dH3%(u(H[]A\A]A^A_fDH=g1ff.ATLg USHoHw8g0Lm@ZC8t[H}XL]A\鳐c0H[]A\G0t AVAUATAUSHoHLoLusDHk(C0HH[]A\A]fD^DLyf1ɺn1H5a11Lwf1ɺHC(H5aH1HH[]A\A]ALa11ɺ}H5[a<H1RHH[]A\A]@S0HHt4HrH{ HHHCHHCH>HCuH[AWAVAUAATIUHHSH(dH%(HD$1RH=DAE[Le1ɺZHRHDH HH!SIHE9DH(DAGIFMf MfHAVLIF8AF@HD$裉I~X蚉I~h葉I~x舉I|11賮IHI.L|$IdžH|$Idž5DH LIdžHIF HI肮LE1wHL$dH3 %(LVH([]A\A]A^A_LSd1ɺUH5*_1E1봿zLc1ɺPHDHNf.HT$HHT$FLHQHT$HIF0AIV(IIfDIF0H@H4LL~H ILvI9uDHDHHDHH9uIF HLE1(Lc1ɺ_Hl ff.HHGGATIUSHH HdH%(HD$1t$ Ht$ HHT$HV kt'H<$t HD$dH3%(u?H []A\C9C@s1LHHtă1H<ff.AWIAVAAUATMUSH8dH%(HD$(195D]H1EAVH5\LbI$Y1^H\$(dH3%(H8[]A\A]A^A_Ðt$HHt$HHT$ HL$HV HT$ Ll$ME]4EAE0AE0M} t'L5IELH@ HPAE0utIEh<LD$ tAM0LAU8A}<1LD$ D$ DDD$ ELDH0IHgH1!AE0t"H-fIEHH@ HPAE0utIEh<I} +Dy@AE4uC8AE4M,$LAE0t!DT$ ErmDL$ IEEt6AE0th<M} LlL$AE0\IEL_1ɺ 1H5 Z ( SG4H}HWG4uj8C0u[DI(\(H{HGH+w<w@HAHHHHIHI9sH [HHHIH)f1LO_H5KY1 C0prfAULoXATLghLUHLSHl@L考u3H]hH CuCuH{LMtHL9H[]A\A]fSG8HuqHYHH{(H{0wHkHC HHZH=DN[HrDpD1ɿ1L}XH5 X HnL1ɺH5W Jff.ATUSH HdH%(HD$1t$ Ht$ HHT$HV ~H$HtyC0t$L% DHCLH@ HPC0us4uqt;H(C0t!L%HCLH@ HPC0uC8u*HRHL$dH3 %(uIH []A\1@HsD 1ɺ/L\11H5V ZYfAUATUHSH8HdH%(HD$(1Ll$H\$t$Ld$ H~LHLHD$蛦HsLLHHH<$HD$n$uHL$(dH3 %(u&H8[]A\A]HLHv$ff.ATIUSH HdH%(HD$1H\$ Hl$t$ HUHHHH$ӥI$HHHD$dH3%(u H []A\rfɸ5gDDHUD KDff.95>Dt.DHD DAUAATU1SHHcDHH~+H5D>tyHV1HHztc9uufLH=DLHtLHJ HH9uHDL-Dw1D.H[]A\A]øLTH5Tf9=.D~HDHcfS19= D~xHDHc4[A1LYH5SiAWIAVAAUATIUSHH(L/Lk1LH HHHHT$O1H HHH1IIJ;HHHL$Ht5HLLT$DH)LL9IGIAT$LT$tZMBI)ti1LDLHJILHAT$t-Mt@ID$H(MHD[L]1A\A]A^A_DH(1[]A\A]A^A_H([]A\A]A^A_@HDLLT$LT$LT$LD$AVAUATUSHdH%(HD$1H9tkIAHHIf.H<$HH9t>I<$MHDuHT$dH3%(uH[]A\A]A^fD@AWAVAAUIATUHSHHH?dH%(HD$1jH L9tyII3fH$HsLHHxLcH<$I9t>H;MHDuHL$dH3 %(uH[]A\A]A^A_Dff.AUMATI̹USHHH?dH%(HD$1Iyńt)HsH<$HtLgLLWLkH<$ZHL$dH3 %(u H[]A\A]XATMUH͹SHH?dH%(HD$1IÄtH$L1HxHH<$HL$dH3 %(u H[]A\f.AWAVAAUIATIU1SHH(dH%(HD$1HGHt(I<${H HD$L9tuL|$.fDHD$HT$HHxWH|$-I9t@I<$MHDuHL$dH3 %(uH([]A\A]A^A_fDff.AUMATIUS1HdH%(HD$1HGHtH?I~ńtH$LHxLH<$iHL$dH3 %(u H[]A\A]gAVIAUAATIUHS31H HHJl5HH1HHHH9s#HfHDLHH9u[]A\A]A^AWAAVIAUATMUSHHHH|$t$HT$dH%(HD$81LT$HDH HHD$ LH1HLILLgLT$1H HLH1HIDHHHD$(H9HD$0HD$NfHL$ Lt$0LL)IvH9HGLHE1HILL)MH;l$(t;LD$t$1HH|$uHT$8dH3%(uHH[]A\A]A^A_ø@AWAVAAUIATIUHSHm1H HHH1HJD-HHH9tIIŽE1fDHDLJADHL9uH[]A\A]A^A_f.fH8dH%(HD$(1HH<$HHD$HHD$LD$HT$(dH3%(uH8DH8dH%(HD$(1H1H<$HHD$HHD$HD$HT$(dH3%(uH8AHHDD$ dH%(HD$81H,H|$H|$HD$H6HD$ HD$ HD$(RHT$8dH3%(uHHAUATUSHHL#H9|IH-QIIU8sI1H5QHIH I%A кP1!HsH=DXZpHLDtI$M9uH[]A\A]AVIAUATIHUHSHK<4HIHRJ<3LHA@u1Et[]A\A]A^f.Eu u1A []A\A]A^ff.AWAVAUATUSHH $HH $HXdH%(H$H!1IH=DHHtBLDH=DHD9t% %9L-qDLLLHH@u~HLH.ulH THHLAǃ}EH _HHLxAǃ}(H OHHL[AǃAI|$1DD/DkHxHuH}HE1@E/EnHxHuA9 L$@LLH$@HHHHD$$AA:$A4L{I} A:uHIuHD$ HD$H$HD$HM/HHt/LIHtHT$LADžHT$Ht$=D$8$%=1Ht/H{E1MAM~A/H9HLAAEfDH$H!dH3 %(DHX![]A\A]A^A_81M4PHLH5LPLV1Y^A4@E1pA1HLHAǃW\f. 8d81LPH'LH5LPLL$1EXZHD$I}LxgAVAULATUSHL9IL/DHsI|$,HE(HtiHL~nHL9tFI|$87-HHu1LV1ɺH5HK[1]A\A]A^[]A\A]A^fL1ɺH5KQ[1]A\A]A^fDAUATIUHSHiHHtHH[]A\A]DH=yD,IHt_HmLHLitHLH[]A\A]@ILMH5]J{fDI1LbMH5+JqIff.UHSHH=D+HHtN@@HHHCPHCXHǃlH{ lH{lHk8HH[]DLAM1H5If.G`uDSHHHxH;H[ff.@AVIAUAATUSHIH HID$H!HE@HHHEPHEXHDžkH} kH}kAC`LHkH[]A\A]A^DHHIHLJID$HHC@HHHCPHCXHǃkH{ jH{jE@H=D)HH`H=D)IHH=tDL(ID$HHC@HHHCPHCXHǃbjH{ YjH{PjfDLK1lH56G|H1|DLJ1|H5FDH=DH1c%=fDLF1H5FLIJ1hH5FLJ1xH5^FLbFqH52F}H1LuL)FH5E@H=DtÐULFHSH5EH1HLOH4iHHH[]hAU1IATIUH1SHx4HLHS~AmH[]A\A]H1[]A\A]ff.AVIAUAATIUHH5SHHDHHH9HQHuTEt[tWMLH11H5DHu3[]A\A]A^fDHHŀ} 7H߽t18MẮ1PHLPH5$D1mXZ[]A\A]A^1E|89A<$MH HHDHLPH|H5CP1RH @1Ep8A<$MH lHHDHLPHCH5KCP1RH @HEZAVAUATUSHH $HAIIdH%(H$1H7EAHHC1Hx;1LLHH$dH3%(uKH[]A\A]A^H1AATLyFH5]BX1ZATUHSHHW8dH%(H$1IHHLH  L$ H!%tDHJHDщ@HL)HDtVwDH}jHHH$dH3<%(HĐ[]A\D|$D-ufH=4LÀۅuH=DIt$ "HHt&H=DIt$$ j"HH[L1ɺ<1H5@:@L1ɺ-H5@1#HH=RDm_ff.fHH=:DM_ff.fATIH=DUHS&_HtH=DHr_I$I9u/HI9t H{HuH[]A\|c@[]A\DDATHUHSHdH%(H$1HkËD$%=@uqHH=2DHp9!IHHxHLH=RD=bH$dH3 %(HĠ[]A\IL?11mH5>7D8Hg1PI1L$?H5>XZbL-?1rH5~>2f.HH=D=]ff.fAVAUL-BATUHSHL7dH%(H$1IIL9u DHIvLHU8HD$(uH9tzHHIH %IMA H5=Q1PHH Av% 1RH=5DIvH \L`HIH9QH$dH3%(uHĠ[]A\A]A^UHSHH=D'HHtHH[]DHI@HH IL=%A H5<1UXZHH[]ff.UHSHiHHt)H=RD蕹HkHHtE HH[]L=1H5.<tfHGHth zf.G@Ht'H?t!SH_u H[H@[LfLff.AVAAUIATIUS6I$I9u ;HI9t0HkLHuE[]A\A]A^@H= DLaHHH=DHH H=;HHkL^u*I$HHpuHL^YfDHL]EHH=mDLHYÅ,L1?1|H5v:H=!DY11L>eH5,:r[]A\A]A^LL:1ɺjIH5914AL$`fDATUHH=DSHڵH={DHIXMHIH@H I A@t~I95H@8L>HHH % H539QP1UR5nH HLZÅ[]A\@LH UL91RH58_H=DAXʹIH1H=DLLw=ÅHLÅ[LT1ɺ1H5D8:DHe]UL?=1RH58 IY^LH7ÅLւ1ɺ1H57 L<#1H57H=EDL[]A\fDHXLa1ɺIHH5G7119@H1IĨL;ATH57URHH L1ɺ81H56M@H@8L5<HHH % H5~6QP1URH=BDH wIHH=,DL蚲ÅHLpÅL1ɺ)1H55EU11L;R=H55XZ[]A\HIHYL1ɺCATAHUSHHdH%(H$1HH)1D$%=@tQ=`t*H$dH3 %(GHĠ[]A\fHt$(H3fHH޿ xtD$%=HɺDH9$u#ExHhDIٹL:H5}412@C8I1ɺPHc4LP1H594X1ZfD8TI1ɺuPH{LPIٹL9SbfAWAVAUATUSHH $H8dH%(H$(1H\$ IHHD$H2D$ HH1u/1HHt-MtLH=#DL[HD$(H*IH=D:IH H=ײDHH=DHD$IHHT$HXHZCaLLOK`HHYAHme81L,PH.H5a,PLL$01XZ+;!H|$MH-H1-H|$L$@0L>1HL$E1fDH蘣HHAD貣HHu H$ dH3%(H []A\A]A^A_ËD$HcT$H=DHHH H H%H ‰I HtPHp(fDHT$ Hw@H=qDD詡HuL$t$|$ALɺLL$tLL$LLHWbf.L-11ۺH5%ZD8uv@1H5$1PHAIPLt1Y^ZD{8$IH tHHDH1۹PH%LPH5P$1RH DAWL,AVH5$AUATUSHH|$dH%(H$11שD3HD$D$L=ƩDHDI9HD$0HD$(@MwHT$(LRHD$0HvDD$zH|$hHHH5$HLL,HH\HHLt$Dl$L|$ HH|$HIXIH|HH;1H!A!LIHu#`@1HLA!CIHt?LHuM1ɺ*L8,H5Q"LIHuL$HHH0HLt$L|$ *Eu-MM1L,H5!.fDM?HާDI9-HD$@H$dH3%(H[]A\A]A^A_f.M1ɺ#L+H5c!fML*11H56!|Li* H5!1LHLML1+QH5 fD8H1ɺEPML)H5z 1ZY@L"1H5N :sCHHD$D$_@[fAWAVAUAATUSHH=DSBHHE1L5m*H=DHiBHHH=nDHAH@HŅxDxDHAH-MAWI1H5eXZEtH|ouLAj1ɺ0H5.y\@E1HD[]A\A]A^A_ff.1DH=DATUSAąH=D)AHHtDH x+:H,DH:HDH9HDHwH=D HDH H=ĢDHآDHH=DH@H͢DHLH=բD?1ҾHHD6IHbH@ 1L vu PHc݃H@kHuH=jIHHHL:(IH^Md$ HMu Md$HMIt$L HHuٹL(H5LfH=iD1Lf1ɺH5H=D1[]A\A]A^DLaf1ɺH5N[1]A\A]A^fDL 1L&1ɺH5`fL&H5.[1]A\A]A^fDL&1H5Le1ɺ1H5룐LmH5c{fLIe1ɺ1H59DLt% H5 V#H=DLH؟DHtL+[LJ&H51LAWAVAAUIATIUHSHH=DDdH%(H$1T8HH@`H&=HHH<D$%=`RHt$(H;s8H<Mt 1HLLA$VH$dH3 %(HHĨ[]A\A]A^A_fHHPuD$%=`ELXc1ɺ1H5H{fH=DDLt$(HI$LHS8AH IHAUI IL$H5QA1AVPHH % кP1H0H\MH\$(LIW8HHHUH IсIL`$ AH5@Q1SPHH % кP1mH0LHt$(H4H=DH5HHI1LH5 DIL1ɺH511DIL.#1ɺH5h11DHXHS8HIPL#H5)HHH % 1P1RNH=DH H;5L#L9u #M$$L9tI|$HjuLN9H1tHL$#bIH51K` DHphL#It$(H=DPIHtQHT$(ULn"1H5 HIH I%A к6P11XLZHt$(HH=DH3HHIL1LH5IL&!1ɺfLY_1ɺ1H5I|f.IL 1ɺL_1ɺFH5K8聸Bf15DATIUHSH]Ht'HѐH}HHEHEHtC`tH[]A\f.1HHLtS` tfHhL,!IH5=1K` H[]A\fUHSHH=D7HtBHDH@HHt(HHH5tH[]DH1[]AWAVAUATUSHH $HdH%(H$1HHHT}1L@L$1LHL$@LC ILL踷1H@2ILHAH$dH3 %(D&HĨ[]A\A]A^A_fD+@1Ҿ1ML1EH56|@LL211AELL轶HMKE1LkH5P1XZH$1H@HHHH3H@2HLRH5 1E1aZ@1Ҿ|1ҾHwHH,AąI61LH5@L 1ɺ 1H5Ǽff.fAUATAUSHHtGrŅHEt Du H߽r2H[]A\A]DKŅtHp7ŅH@2HKH??ŅuH7MH=LN11H5Y蟻H?0f1L7Y1ɺcH5)oH[]A\A]f1LY1ɺhH5 ?H[]A\A]fE1HAADc>ŅtmH8AkHk>^fDHt 8L1ɺ}1H5k 豺DL1H56 |L1H5 LHSH=HtH=Hσ kL@2Lg1tH5 ȹa1DfATIUHSHdH%(H$1FÅ4HḺD$%=`tTM.LH5 11 H$dH3 %(0HĠ[]A\fDHt$(LÅH=:DLZ*HtHH.fDÅH3H;ÅHEÅH;fDLU1ɺ 1H5 fLU1ɺ31H5 ߷f.LyU1ɺ1H5i 请f.M)L; gL11ɺH5 aDL)1H5 ,L1 H5 Ht:LT1ɺ61H5 Ƕf.AUATIHUHSHèHLHItFH={LÀۅu8-L#HtHxLH1ͦH[]A\A]H1ۉ[]A\A]fAUATUHSHHH9tCIA HH9t0H{ HtfD9cuLuHH[]A\A]fDH1H[]A\A]ÉAT1LcUHSHHHt Ht 1HfGt=H#HtnHP@< u"J #H9rQH9tEH< tt6< t2J<#H9v)H)1< tHH9t D D uBD%[]A\ff.AWAVAUATUSHH $HHH$Lf8MHt$IHH\$0DD$IEHD$dH%(H$81HD$(HD$(HD$ HMMAUI AIAHHA A1H,ٷZYLct$Et]HL$LHHtfHD$t[BD5H$8dH3 %(HH[]A\A]A^A_1LHH(t }ufDH|$(u(HT$Ht$I<$譯uLt$(fD1yH|$LRIH5N11@SAUATUSH%=ڬD-ЬD9AAH1ҾlHHLM1HH=zDEDD W@EADAAL1ɺ 1H5h;fHt DH[]A\A]fDA1L<1ɺ H51H[]A\A]DBH=D1踥Ņ~Dt-:V@D%zDjD1ҾHHD$LkHL$HILO1ɺ 1H5g:D軧1L1D 1H520@DLN1ɺ 1H5ϰf.LiN H51衰@#1ɿL=D 1H5ou10@7LM1ɺ 1H5^1ff.@HD@HtÐHH=3РtHָH=%Hָ H= Hָ H=Hָta H=HָtAH=Hָt! H=HtKHtFHF0Ht=xft2HH=(vH€u1H1Dt#HtHF0Htf@t H@ 1ff.fAWAVAUATUSHH $HH $HHdH%(H$8 1u2H$8 dH3%(>HH []A\A]A^A_@HIHHD$(I@21ɺ-1ILH5f>HH5+H\$0IHL$0fDLH蠏H|$0#tHH=jHH=s|H5H赑H5zHH裑IHwHnH5ZHH5SHHD$ kH5DHHD$W8HD$3HD$HuLHu$0LLW$0t<.31HD$ Ht?HǺL'$0t#<.tL_HL$HHA(DH|$t@H|$L$0t"<.tLHT$HB0H@H|$t@H|$L$0t"<.t 1LHL$AHt$H|$(@H5uDH4L uD11LT:H5講IHH5uDHݒuL nuD=guDHLDH>1UL1ɿH5nFXZ/HߺH5tDL tD11LDH5$L(&1L81ɺH5迚DL1VHT$HHB @L1ɺ)H5q@HD$Ht>HǺL$0<.t"t 1LHT$BL1ɺy1H5,H|$uL(HT$fBf.=sDL sDH-DL1ɺTH5葙|@1L1ɺ0H5g1蛐ff.ATUSHH $HH5&L%H@2H$dH%(H$1ВHH4@HH耊H$#tݹHLuHHHߺHHqDH1ɺ]S1ILH5dHH詏ZYH$dH3%(H[]A\@H`t1L51ɺfH5(1L51ɺY1H5ϗ#f.1L1ɺOH5蟗1IӎHHH9uHH9tfxu1DHHH9tH;pu H9pt HH9u1ff.HHH9tBfHP0Ht(H LBH3L3FI uHJLBH3NL3FI t HH9u1@ATUHSHH9t"IfH{(Ht Lύt HH9u1H[]A\fAWfMAVIAUIATIUSHHHdH%(HD$x1Ht$4)D$P)D$`D$pHD$8D$4cH{ ŅA$0u6HL$xdH3 %( HĈ[]A\A]A^A_fAoMAoU)L$P)T$`MLAfMt=LHHD$8HML11H5X+AHLHHD$8HML11H5HC8I$HHcJ %H9HcJ AH9t!Hc AH9tHcRAH9AfDfAAEDAHLBHD$8HtHL{ Ls M9t#fE;ou @fE9oM?M9u(H$H$HIrfDhHLHP HX K`HLL{0HD$8{LIHD$PHH$HHD$gLHIW AwLHD$vHD$MtHI}3HI(H1ɺjAVI1LwAUH5it$8H HD$HtaHxLp0HЅHtѩHHHT$ AVHT$(1ILNH5 1Rnt$t$͒H HD$HtsHH HxHeDpHL$ Ht\HHHT$(LH1ɿt$(I1LAVH5HT$@Rrt$0t$(PH0HD$HtaHxLp(HHtHHHT$ ٨AVHT$(1ILH5"1Rvt$(t$H HD$HttHxH9tkLp HHMLDHtkHHHT$[H1ɿAVHT$(I1LH5R{t$gH HD$HH@H9HI$HT$@HjI$HT$HAHD$HpLAHD$HxHD$HH9D$@蛧HMw HD$芧HT$L1IRAVH51螐^_MLHCE1IH6@HD$L艂H!AV1t$I1L8H5d7XZI} LI}(CI}0:AGI fAE跆HIE 軦H裆I]H<$IE(蒆IuHIE0҇I} I}(I}0I$LLL7-1ɺH51mL -1ɺ1H5l1=gHtI HH$kH$H'fLxL,11H5׎fHD$HbPfA;WtoHLIHD$Hp Ht#MLLL$ՅLL$Ll$LL$LHJL4$LL$HD$@I IHD$PT$ HDt$4HD$פHLT$(IH51RHL$(Q1AVH =fML.11H5謍A$LAMw HI/H1ɺAVI1LAUH5pt$?H 8,IHL*1ɺ1H5,)f.Ll$8HLL] HT$8ApDMw HtH1ɺIAVL5H~L1*11>H5gfHD$HH9XHI}HP)Mw E1HD$DLXLHT$8fDHD$HxL1ɺ1H5ы>LHL.tkHT$8AU1H=)LL$LL$f.Ly1ɺ1H5}f.L1ɺH5}@L!1ɺ 1H5W}fL1ɺ1H5\/}f.sLDH5#1|pLH1ɺ1H5|Irs11HѺff.@%=uZXvDtPJvDStM @ pvDju] @[Ðu= @L31ɺ 1H5{o @fLi1ɺ 1H5{D#rL1ɺ DH51o{ @2@Ly1ɺ 1H5l[>{ff.AWAVAUATUSHH $HfdH%(H$x1)D$)D$ D$0)D$@)D$PD$`<t,H$xdH3%(HĈ[]A\A]A^A_HHIH9uHH9tfxuo:LHH$)|$oz)|$ o~h)|$@o~x)|$PI9%L|$@D$ Lt$LH\$pMI1HfAoHID$HLfAoWLVM-oX o`0KS[$c4HHH@0LM(HUlL1H5HHDMLDH1AV+AWP1hyHE fAo.H D$ hfAovpHEHtH@0Htfxt4M$$L;$$D$ t Lt+L1DfAo>H@ xfAo~xL1ɺ6H5xofSHdH%(HD$1D$HT$HuHL11ɺ<H5yQxD$HD$dH3%(H[HtlHuL1ɺ@H5wLg1ɺ-H5w@H8nL1ɺB1H5w9nDAWAVAUIATIUSHHXL$$H|$0dH%(HD$H1H|$u)HD$HdH3%(RHX[]A\A]A^A_fDL!1ɺ1H5HvLL9D$D$ Ld$MfMfA~wMtLL_AD$b SHH LHHD$ M~0A$:M$MI$IJI3I3OH IBIJI3GI3OH k@Iv(I~HHt$(M蘌Ht$(HmIV(HI~HHDHT$(cH1ɿHT$0I1L7H5RuuI~XZ*HlHHD$(t(I~(ogHD$(D$IF(HD$M6I9dLLd$L9AM~M#fA~MtLLAGb LTHH ҽLHH IF0H8.D$ AJL*HMN01PLpH5o1@t^_H{谨HtLxH|$HI~ Ht ,fIF Ag`IG0D$IFA$@M6I9L|$0L;|$L-XLt$fDM?M9thIwHDHuIFM1ɺIH51fsIW1HHHPI7M?M9uHH9uMf.HH9t;A $u3HP Hc:.ZfxuHxuHx0tA$T$DL$ L11H5rmfDL=LLT$(LAWLT$01IL1ARH5LT$8ZrLT$8Lh_AXIHI~0UdHD$Mf0D$fMA?.L赈H1ɺAWI1H5L]qI~0cHD$(IF0Y^D$A$H@L8CLI-H1ɺAWI1LH5pCqM6AYAZI9s fDIIHNH3H3HH HVHNH3PH3HH L襇IV HIHHT$hHT$IV(HHLHT$gHT$HML91RH5Y1npLgAXAYIH~I~(mbM~(D$A$\@LHt$Ht$MN01L)mVPDHD$$DL$ u.L1ɺ1H5oHL>1ɺ1H5o^LHALHD$;H1ɿHT$ I1LH5{R?MoA_XmDL|$0D$ D$L;|$dJH`xMN0AWL1RRH5nA$AZA[fL|$0L;|$fAWAVIAUIATUSHHHt$0L$L$,dH%(H$81H$HHD$LAIH=IIHHƹH=2AAED$H9tzfH{0tif{ubHCHt DHdEtPI~@BHt=LK0E11LdH5mMt AEDHH9uH|$D$(t.H$8dH3%( HH[]A\A]A^A_DIZL1ɺ11H56L%w`m11HHtHLūIHAEbuILLLHtIH LLHtIH LLHtIH xLLHnI~РHWLhHLCAoH|$H@AoIH(LK0WH舂L0LA1ɺNAH51kL$D$8D$HD$@M9HD$|H\$XHD$ L|$f.L$|IH HLHt_IH HLHtBIH oHLHt%IH HLH@H0M$$L;d$tEt$I\$uHLݽHt$ HH0D$8M$$L;d$uH\$XD$@1ɺLH5PD$@PDL$X1kjL$A[]Dd$,ELd$D$HM9Lt$E1MD$=InHH|$IvD$(IHHt fx+M6M9tI~Ht utM6AM9ut$(D$H"D$ELt$AąD$,L$A!Dd$ Ld$M9L-^@M?M9IoHtI1HLHPI1HLHuH:HHD$HT$1MIIGH5<RP1iZYHtHCM?e`M9h|$,D$`L11 H5hLH$H;\$t@Ll$0Ld$HkHt"I~HtHhHL HL9ù|$ IH5H=laHHX`L1ɺC1H5gf.D$@fDLx^LHD$ k^LHD$8^^(HD$@_H|$ IH|$8H|$@HDT$,ETH{ L\$L} jYH{(aYLIHD$ L\$HC HD$8LHC(HD$@fA{LIC IkHkM`L]0HsH^D$H$H57_tE>]yH1ɺ\PL^L 1H5vf_AXDL 1ɺ(1LH5sFfH$L]IH;l$.LH\$PLLt$hMDt$HLd$`ID$IT$I3EI3UH H}H|$P|H}HD$H|HT$HM1L9H5RP1eXLOZ1ɺH51teM1LcH5z1PeLHIHH;\$HLeHEIT$I3EI3UH AL|$PL{HM1PL'1H5dL}A_XfDH|$ L\$PVH|$8VH|$@VL\$PLVLA11H5wdwD$ L1ɺ 1H5yLdLH1ɺ 1H5S&d}H\$PLd$`Dt$HLt$hHD$H1ɺAWL1LH5cAXAYL\$k[fHPufSHH@=-@tH[fD[fDHLJHfHLJff.SHHHtWHǃ[DUHSHHt HH[]HHHtHHS8bHZHHHStOHHHH[]L)1ɺ:1H5_buf.H1yLBIH51b5f.L1ɺ=1H5saf.H@H[ ?HfDAUATUSHHLH@H' ?THHt[LM9t@HHI,xATsLVAUI1H5AaXZHH[]A\A]ÐHHHIwHH5ATIL1p`Y^HH[]A\A]AUATUSHDEtqLMteHH@H1 ?TŅuWHLHI=wAUH5ATIL1R`Y^H[]A\A]HXHIvATLoAUI1H5`XZH[]A\A]ATUSHHt9u'ǃH[]A\t$ t$ uHvH?HL$>vHLATI1H5Q_XZff.fATUSu []A\fH8ŅtHǃ[]A\HHIuHL}ATI1H5<^XZ@USHH@OMuKC@HLuLdIH5E1e^C`u_H[]T84RHHtU1IHܥPL11H5 ^XZjDHH[]2gfHtLkIH51]1HfM@@SH@C`u11aALy {@Px [[bYfG@x-GD~GDtHHD3G@xeSGD~GDHuHH[ÐsLIH51\H [Dff.AWAAVIAUATAUSHdH%(H$1pʼnLD$%$sE^@IExJD$AV`AFDEu |$} AFDL5AF`Et@? >LDں1OAF@AF`E<AFD $|$D‰ƒEAF`@@AF`E$AF`H$dH3 %(Hĸ[]A\A]A^A_f.AFDDIV8H1ɿLH5HIH I%A к9P1Z[]1ifDt/t+1MGLH5GiZAFDLAFD6afH5o MH IHHDΨL?HDH5HHEHH5QRP1YAF`H [P8HE6AF`@+1LHL$MHL$AF@Af`1MLwH5.UYAF`@fAv@HT$JxIF8H9D$81MLH5XLL1ɺ1H5XDLa1ɺM1H5uX]f AF`@EtqHML1P}H501PXAXAYAN` ML11TH5X/HMPH5Lp1W^_AN`LHD$1KHL$AF@Ml1LuH5FhWA~@1 PIFxNf1ɺkff.1ɺ1Nff.11111ff.AUATUSH(dH%(HD$1HHG`t+HL$dH3 %(H([]A\A]f.II%ŅL$$H-lLl$&H߅HkHDlHMULH5P1ATUH ٷu{@HwDHt,LI1ɺH5Z|U1fL 1ɺ1H5?Uf.K8IHHkH1ɿUIL1AUH5ATTH H'L1ɺ1H5TKff.fAVIAUIATUSHHDgTdH%(HD$1HH$D$1E~1H{DB1HT$hDBT$ы$KLCHAAUHL$dH3 %(H[]A\A]A^fŅtH߽hjAbGHGL1ɺL:1H5UwSD$11TfDL 1ɺ1H5?S$H&L1ɺH5S7JAWAVAUATUSHdH%(H$1HHIG`jiHDkTI+LD1ɺ]ŅuuD5(?D9shEm1LrDAI$HM1LxH I$HCpDshP@L1ɺ>H51Q1H$dH3 %(HĨ[]A\A]A^A_fhHIPŅuD5[?D9shHLJIHD$0HM1LQH I$HCpDshP1H51SQXZJG8$EH1PLMnH51 Q_AXH(ŅHgLr1?}I$k?H1H5MH LI$HCpShxP1PYH^a(L"1ɺ{1H56SPQfDF8,DA}MH eH-HDHL BPH.#H5P1RHOH L1ɺh1H5Of.HspM1LB1H5YOHCpI$A[[sHMsp1LafDE84CHM1PL1nH5OAYHAZŅL1ɺp1H5NFf.ATUSHdH%(HD$1Ht_HIG`t3HL$dH3 %(H[]A\fGPH$t1@sŅ{@1Hc<H$HA$CPA,$dH1ɺUIL`H51MXHZ0Lq1ɺH5M @+D8AHIIdH1ATI1LH58_M_AXC84AHHcH1ɺUILH51MYH^ŅL1ɺ1H5L>DAWAVAUATUSHH HdH%(H$1Hw,1H$dH3 %(H[]A\A]A^A_ÐLIIHLL8$==HLHHu=$=t =\L1Dt$D$蜆AE9D9H}bHILPAVATTfDL1D|$D$<A9tKA9tFH&bHMLhPuAWSH5;17KH fDMuf.L1ɺgH5J1Pf.I]8fLy1ɺ~H5J1ADHdH%(HD$1HL$t)1|$N+HT$dH3%(u/HL1ɺ,H5.1J1hAAWAVAUATUSHH $HIHHIdH%(H$1M茑IID$8HD$MA}IHcKILH9fHc H9ILH$HI AUAHfHA 1MY^gHT$ H޿AH5HBIHH$L@HHD$:HH|$LL1 ABL1ɺ@H5BL1ɺHH5AHXHH5ԺPLL$( 1LpAHD$(Y^H8ff.AVH HAUATIUHSH`dH%(HD$X1Ll$HD$M&t)1HH\$XdH3%(,H`[]A\A]A^HH\$W1LIHJSPH5ݹ1@A[[H\$H tLt$H HLMHy~D$]HVWAVLI1IH<~H5hP1h@LL1H5)3AYAZDt$EMH ?HLHD$HDd$VLڹ1ɿIHATPH5и1?HcL$_AXA H5DHcH>HHTVH1IHؿH LH5dP1d?XZDHcH@HcH@HUHH5AVIL$1?Y^76ATUSHPHcdH%(HD$H1HF8H%H9t'1HL$HdH3 %(HP[]A\fDIH H}HM\ÃuH-UAT1ɺIHPH5KPL1?>LZH=6YbH=LB?75AWAVAUATUSHdH%(H$1?/tOLX1ɺH5ݽ=H$dH3%(?H[]A\A]A^A_IH5I147HIHDLH.Ht[$<#tI1L1ɺH5Y11D$IL#11H5&0XL1ɺ1H50bf.H|$fGHLޮAVI!AUH51AWu0H @L1ɺ1H5G0D$f.&H|$D FH5=ATI1AWL/Y^@L 1H5/H|$l$fDHLL$CLL$6H$0dH3%(LHĸ0[]A\A]A^A_f.MLΡ11NH5!H؋H!ʁ t€DHHHD@H1H) HH9<3 u3_H؋H!ʁ t€DHHHD@HH)fIL118H5 E1@Ly1ɺb1H5 LL$DE1LY1ɺ01H5o E1aL7LA1ɺ?IH5w1; E1-nf.@AWAVAUATUSH8HT$dH%(HD$(1HBfEH8HHt$HHT$AISWAP-SPAISWAPSPACADDD H9A_Lt$ HLHL9d$toM9.HS1SUSPENI9HS2SUSPENI9HULSUSPENI9HV H9D$t%EAw0HT$MfDfA~CEuH|$Ht H1HL$(dH3 %(H8[]A\A]A^A_fA~E2tHS1SUSPENI9IA~DtHS2SUSPENI9BA~DtHULSUSPENI9;A~D0apf1L1ɺ1H5M;Lf.fUSHH $HH_8dH%(H$1H|eIHI IHAH$A1A HHI!xEHH޿t[H$dH3 %(HĨ[]H13Lw1ɺ)IH5118t/I1PHLKPH5b1XZ^@S1HdH%(H$1HHt_1f$Ut!H$dH3%(ujH[DHHs@uCEHH9uDLٹ1ɺ]H51D1?ff.@AWAVIιAUIATIUDSH(DL$ L|$hHT$dH%(HD$1HD$T$pDL$ tyD \$`u1LH=!LeE1HL H!%tDHJHDщ@HL)H9r LLuA@IAA?uHD$HLLx M?A?Hl$(UfDAu]IoH H9rHLLau A4MMUA?MwLMMu1MLWH5m H|$H<$rH$H$dH3<%(H$"HĘ[]A\A]A^A_DHc1|0BD$2fHT2HDP 7H<$IcŃL(&11LqH5E H<$HG$H$fDHH9uB8pL1ɺYPHPLL$01H5Q XZMcH=>IcK@TH<$T$1LL_H5 H|$9|8LJ1ɺNPHdPLL$0`1ML~_H5- H|$08oL1ɺaPHPLL$0Hl$(L51H5Ō0 H|$a8$H HHDHPHrLPH5Y1RLL$@n H iL'H5! BH$HMcHl$(BL$8W$H HAHDHPHL'PH51RLL$@ H HHNFbHV8HcO H:HH9HcHH9tyHcOHH9tiHcOHH9tYHcOHH9tIHcOHH9t9HcOHH9t)HcOHH9tHcG H9HH͋HD1HcD$f.1 HcD(AWAVAUATUSHH $H_\dH%(H$1IHDŽ$t5AH$dH3 %(DHĸ[]A\A]A^A_ÐLg8HL$OLMMAHI I1AAA HŠ HLAąt!E\AAEJL$1ɺLLf$t\ 1LAE\AEHE1ULkٺIH51q@H LٺIH5ӈ1<HL9ٺIH51R:f.ATUHSHv8HHH߁H}8HcS LcHH%H9tNHcH9tFHcS H9HHA~^HU8HH %H 1IHu>HKEH8YHE8HcSH%H9tWHotVgt`1[]A\fuHH,pHtfDHt[]A\f.HHtsL`H5QLHwHE8HcS H%H9tH56LHHtNH=щ,f.L1ɺ~H5!1Lá1ɺH51L]1H5eff.AVAUATUSHH $HH $H`dH%(H$X 1HHV8IHHH%D$HH % ЉD$ ~uHc|$At$H/u;HE8HH$X dH3%(aH` []A\A]A^fDDt$ Dl$Ld$PJHLHE1E}H$PLH]HHƄPCHI#JMLHH51gH5LIHtLt$H¾@LHHL$ HT$L1H5+ŃD$ HcT$HHH H H%H HLF89M1PH2LPH51XZ\L$ ș<)HHcH H HH H DML1ɺH511DHL1ɺIDHHHLы1ɺIDK8L11PHMP'H51|_AXU@H1H5MAVL211DY^rD8|$PMH HHDH1PHRLPH5v1R,H DML11%H5A1SHHV8HcO dH%(HD$1HH9t:HcHH9t/HcOH9t&HcOH9tHcOH9tHcOH9t HcGH9t1H|$dH3<%(u0H[HPtH$HcH%H9,ff.AWAVAUATUSHH $HxHIIIdH%(H$h1RF}HD$OIHt8uRL+1ɺhH511_H$hdH3%(Hx[]A\A]A^A_@HD$`IL$8HLHH$ÅH$H5sHIHHl$ LҾ@LT$HqLT$H1LH5͹HLT$LT$L+8j1LPHH5PLL$1KXZ@L1ɺeDLњ1ɺk1H5f8HT$LLHD$LL$HL$H<$HLLL$eLL$H<$H5LL$aLL$HIA9t>cL1ɺPHPLL$H5~1=_AX1I1ɺtPHL~PH1ɺULL$LSH5o~11Y^LT$5S8L!1ɺPHNH5*~PLL$L;1ɺ|1H5~q ATUHSHHdH%(HD$1HH$RtsHL$$H1ɺIHjPL1H5}ATSLd$ H LH tHT$dH3%(uUH[]A\@Mu 1HhAT1SIL41H5}XZATHIH5z~UH1S1Ht\ 1HH HA$NHE $1UFL1H5|XZ[]A\I1L1ɺIH5a|[A$1]A\ff.fAWAVAAUI1ATUHSHxHt$8H$DD$DL$dH%(HD$h1蒽HAHD$`LHDHAHH}5??S$PDt$0L|$(ELH u*H\$hdH3%(DHx[]A\A]A^A_@H5??ELSA LH$Hj}PH tH5}??ELSALH$H@}E1P{H AZ@HD$,HH|$HDnAąH|$HHH;H&H HH_H0EL|$81H5[HHD$0LHD$8HD$@HD$HHD$PHD$XHD$`HHD$8At HH=v{€fAt HH=]{€AAtHƹH=D{1HT$0H57{H/'$LL$8HsAUL1H5.yXZHAED+ 7AH HvHNEAH1PL1EH5x0XZH1LH5{zH\1HT$0H5dzH>$LL$8BHAUL+ fDHL$`HT$@HH5yto$LL$8OH|AULXL 1ɺ1H5w?f.HyHD$HH|$01 H|$HIdHT$P1H5yH>HT$X1HH5y=(HM1t$P1t$HL$H58wt$pt$pt$XLL$hH0D$ LH=xHL11AUH5vC_AXHT$`H|$L螭H|1E1L5H5vHLu1ɺwAUH5Pv1A[A_D$t LH=w!D$tLH=wD$ $u&HL$0LL1H= =LL$8t1fHT$H1H5'vHDHL~1ɺAULs1H5s<rfHH5uff.fHH5uff.fHH5u}ff.fHH5u]ff.fHH5u=ff.fHHH5udH%(HD$1H$uHt$dH34%(uH~ff.HHH5yudH%(HD$1H&t$Ht$dH34%(uH%DSHdH%(HD$1H6EH8HHtHH\$1Ht;|$LUKSt%HL$dH3 %(uFH[1f{uL1ɺ!H5~5뱸bfAT4IUSHdH%(H$1HHHLA|$@1HھD1탼$x@LKt'H$dH3%(Hİ[]A\fL)1ɺcH5}aL1ɺWH5}15H8 LHL8HHDHZIH}UPL11SH5^}H 1>Ht@~MVu1f.1HpH9t@1f.DAVE1AUIATL%FUnSHHHIcDLLH1AIHCH9u[D]A\A]A^@DED^E11E1IA uA }SIcEAXHEtR_IcAHDE1DI9t-HDEt A9}A ut'A uAI9u[@Ef1@AI9tHDEt A9JfD1@1DAWHcAAVAUATIUMt$ISH(HT$Hl$HdH%(H$1HM9iL$$H$E1EusAIvHHEH=lE9HH=lHT$HE~@AMt6L;4$AVHLHE~9BI~A AHھEIٹHL:z1AHT$AHDO=E~AMt6L;4$HDEH$dH3%(DH([]A\A]A^A_ÐAI~HIٹHLyy1/HT$H=ADNE~@I~A AtHھAtAd5fHھIٹHLx1AHT$AHDOE~EAwHH8HEH HH HH9ufDA:fHھHھ +f.@t't5t>t@tB-t#1HHDøڸӸf.tt-t6t8t:1t1HHHDøڸӸfATIH5IwUS€tmH-U1LHt`Hu H5wL€t)1MQLƁH5v1[]A\fDHcHֆH[]A\f.HwHiHcH>DH.HHHqvH6HHH=6HH=vHָtqH=}HָtQH=FHָt1H=PHf.1ff.fHӑ>Hff.ATUSHGYuLgHHKPHGv ǂG1HBM1HHHx8HSPHGDGH[]A\fˡL`HwfHCPH1LLAT1H5tXZDATAUSGHv LJG1HBDHCtHZxGDGH[]A\@ELt11H5sDHHHjDLIH@HHHjDL H@HHHjDLH@AWAVAUATUSHhdH%(HD$X1HHl$@HHkD|$HH3HDDLL)T$ L$D$ iHIfHLy}UT$IH5HrRD$PLAVL$0Q1P1AUAWAT:HPHD$XdH3%(u7Hh[]A\A]A^A_L1ɺH5q*f.ATUHS7HHH9L%q@HPLqH5oqHBPHrH1L@1dHC 1LqDH p$DΉH5 q$1-HXZH9tgDKCH1H5pMDȃP1HC Y^HELdq1ɺ1H5pHH9u[LQ]1ɺH5p1A\Lp1ɺ1H5_pof.AWAVAUATUSHXdH%(HD$H1HHII@LHh\DH-L pH5oL5ypELpLE11H(d1LpIH5o1HLDfIuLKpH1H5_o1AVL@p_HYHH_HH9ILI)HIHLLH(1PM1L#zH5nXZ+t Lo1ɺ51H5nDA$bDLLo1ɺ<IH5Mn1[D11@LoH5#n311ALoAH5mD11LoBH5m<$CL #.MELo11H5mLM11DH5mHD$HdH3%(HX[]A\A]A^A_LII)IH@ILCn11*H5"m2MDAL}n11>H5lHL m3LELm11H5lfDLaz1ɺH5lff.@ATUSHPdH%(HD$H1H[HI@LH%eŅH߽`1LnTIH5k1 <$VL F,MELm11H5kHmL lLDȺX11LwH5kH1ɺZDLmH5akD+P1jXLZ1ɺ\H59k1GHL$HdH3 %(uXHP[]A\@Lx1ɺR1H5jDLx1ɺO1H5jATHE11UASHH0dH%(HD$(1HGPHH8D[pLC`t 4$1҃HCXAE1E1H҃HsPHH6WAQASL@H5jRrUATARAPLuP1QsHQ1H`HD$(dH3%(uOH0[]A\1҃HCXL$‹|$DL$ AHDT$]HTff.fAWAVAUATUHHSHHdH%(H$1HD$@HD$HHD$PHD$X\D$L$H{ @LaAŅ1HL$`AHAH8HCXDD$`%E E1L5jHHjLDLtk11H5h1ҾH豜AŅ HCP1H5OhLjtHsH1L@>Y^HCP1ɺLjH5hL1M1ɺL{jH5g1M1ɺLjH5g1H}HWH}HIH1ɺATI1LjH5ng~AZHA[AąO11LsH56gE1CHHLpH9 HD$HZLoi1ɺIHH5eLHH1IEXHt%LHHLMi11H5eIHt%LHHL6i11H5eIEhHt%LHHL#i11H5]emD$,D$ETHSXf HX H.1LhH@H5dLHH1HSXD$$D$@Lr1ɺ1H5dH$dH3%(DH[]A\A]A^A_1ҾH蹘L$@AHLLpI~ B]AŅ/ 11L,pH5&d6E HAvHL O1L[fH5c1IFPAY1AZLNfLH5c1M1ɺL8fH5c1H}H8L'f1ɺIH5fc1tH}HcL f1ɺIH51c1?L1ɺ@%UfDHPE1E1HCXH$H%HT$H1HID$$AD$ HVLf1ɺIHH5}bLT$LHH1LT$1LYfH5NbIH@LHH1MDl$HSXD$,D$IIDAH D$(EL$du  T$(H duHEL cHpLEHLo1P@1H5aA]XE, MR IFXHHLf1ɺKIH5Ea1SHD$PHlpHLf1ɺOIH5a1HD$PHpvLuf1ɺQIH5`1HD$PHpBL]f1ɺSIH5`1HD$PH1L nVH@H5m`LH8p@1yHD$`AY1LnYH@H5:`LHHpP1FAZA[LeHD$P1ɺ[H5`H@LHX1HD$P1Le]H5_H@LH`1HD$PH8DD$E|$_MIFX1ɺnLeH5~_D1HH1LerIH5I_1WD11LesH5_/EfAvTHLe1ɺzIH5^1CY,H FLe1ɺAH5^1{`Le1ɺIH5^1DKpAE Le1ɺ1H5H^XED$D9Kpt!Le1ɺ1H5^ CXtODKtEx!Le1ɺ1H5]DKxLue11H5]H1ɺD$xH5]LePDL$|1Y^L01ɺH5k]1AsfDHpLKHC\ L$`1ɺ1H5])@IFPLi1HAvHL@DAL5 _H)|$tL5hH^LD DH谊IHEIFXHPHL ^EUHH5^\11RLWiEZ^_QLD_1ɺ1H5\/f.Ht$H}pAąt;|$<HkHEeE1H^NEtH]CXDKtEDKxL&c11H5l[|Lb1ɺ1H5?[Of.HhD$HSXH0rQH-@d ND$,D$D$$D$fHNIEHCXD$,D$ID$$ID|$DD$AH L$(sDH(sDERT$(H~\L \oNHHt)H@1ɺL^H5YLHH1D$,HSXD$D$$D$fHM1Lk`DHLH5Y1CZ@LBg1ɺ1H5XYhwt$,H1Lg_kIH5"Y10MqD1ɺn1LH_H5Xf.t$HT1L^dIH5X1t$$H$L^1ɺfIH5X1Le1ɺ<1H5WXgDL$h11L}]GH51XAMH@Le1ɺ}1H5W;fE1E)L^1ɺ1H5Wjft$WH5RLHH1I1L,WH5RH@LHH1 AL b8ff.ATIUHSHvHHHڋ HRH+ZHtHBHH1H57RMPLCZ15HYH{^CUPML"Z1ɍTRPwfHBHxHYHtGFHLY1MP1H5QH_AXHDHxt2@UPMLyY1ɍTRP1H5hQxXZ[]A\Ð[M]1LY1A\H58QHAWLY1ɺAVH5 Q1AUATUHSLHLM9L=*YL5+YHPfDAU AE$MHL"YЃEZPME11RXLZwK1ɺHILX1wIEH@ Hxpt;HEPLHHx5I1ɺHILX15IEH@ H@HtLMmM9:1L1ɺH5OH[]A\A]A^A_ff.fff.AUATUSHHXdH%(HD$H1KL'X1ɺH5eO)1qL11LXH54OILMA9HLDLW11H5N HC1ɺLWH5NH@LH81ܾHLW1ɺAH5N1谾DK(11LWH5vN苾C`%t!=fHH JHIHH x#HIHL1\H5 NQ1L-L%PRP1H HHߨMEL yVL[MDH11ATH5MȽ_HAX D1ɺ1LVH5|M茽HT1LVAH5RM1`Hh1LVAH5&M14D11LVH5L D11LVH5LA1ɺ LV1H5LH;HH1LV IH5vL1脼H;1LMIH5DL1RD11LMH5L*+H;HH1ɺPLV1H5KDD+ػXHZH;HcH1ɺPD1H5KLU薻Y^H{hH@H`DLU1ɺ"1H5GKITL11#H5#K3HD$HdH3%(HX[]A\A]@=u:HHHILX1ɺH5JѺ=HjHHRL L_11LSH5wJ臺CaHL SLDȺ11LSH5@JPL wAWAVAUATUH-TSHHxDdH%(HD$h1EA)HC`%H=t'H-@TH=tH=H-LQ1H5tF鄶@ALU1H5>FNfDL1U1H5F$@LT1H5E@LT1H5EԵ@A1L"UH5E驵fAWAVIAUATUSHHt$HHT$PHL$XLD$`LL$ht=)D$p)$)$)$)$)$)$)$dH%(HD$81Ll$TE1҅AE111AEHD$,H$E} H>H8԰Aǃw>IcHDP@t HcÃD|,A=wSMcHFLLH$0D$H;HD$HD$@D$0HD$ 詥H;A,E111'A tT$T$H8Ǫt$T$)@A HH1>L$H8腪L$HI> L$H0PL$AyH- REAnH-Q3H} H}uH>H=ZLH詫nz1EL/L1ɺH5iAyD謨 DF$G$FPGPf.WHt$H|$ff.fSHH'ǃt [L_Q1GH54Q°[ff.SHctժCt ǪC[D1HH5Cm¸tC[f.H5PHASHHHtDHT?L ,1ɺiHC L|H5UP1LK(HCaկH[LyM1ɺc1H5!P误f.SHH(诡H[馡fDAWLP1ɺAV1AUIATE1USHH5PHDHE1H-)L5PLi2HHHt HLtiHLtS HH=0t9IE1HH@PHxRL1HtDMtIGIMt.fDH[H[MH[]A\A]A^A_ILL1ɺ"H5O<H1[]A\A]A^A_ff.HHH*f.UHHSHHHt\H%S?HHC yIHC(HtmLPz1ɺQH`HCH5_N1莭HH[]@LyN1DH5+N\f.L-N1JH5M,H1BUHSHDO EuBH]HHtfDHHPHHuH]HHH[]@LM11H5KN褬fAVAUATUSHnH]HtHIIIfDMtH{(L跣uHCHtLLHLHH]Hu[]A\A]A^fDAWIAVIAUAATIUSHHwL LHkH]Ht7MtH{(L/uLLHLAŅt HH]HuLqLHD[]A\A]A^A_ff.@ATUSH_IHcHH HHHSLH_0HD7HHHHkLLHHbH5LHCHSHCHLHC(1C ѪH[]A\fLiH1ɺK1H5FL1蝪L L11ۺNH5LrLK1VH5KLHdnf.DUSHHDO HoEu.H}MHEHPHHH[] DLK1H5MMĩfATUSLfHt/HHH9t@HsI<$HH9u[]A\fDI<$[]A\3AWAVIAUATUHSHHLnHtH~(H萠HAąuYHL=cCڿI}HL9 L>CL95AHHD[]A\A]A^A_@HS8HE1LJH5,LHIH I%A к\P1聨_AX@IuHHLHH[]A\A]A^A_IEHHLc`HAąCa LXCSdMDžuDHL9CL KMHH5^KPLK1ƧY^H+H9uHmH9HuI}LcuL(JE1云H5JjDCduHL JVDHALJIH5J1 K` H谽L4IdIH5TJ1ɦ@HArLIjIH5J1苦fDATIUSHcHH8HL`HXHtoHEHt0 HHHHkLbIHHH5fIHCHHCHHC(1C 躥H[]A\fLYC1ɺ>1H5I菥LpH1H5HkH}HtH1sH[]A\LH11ۺH5H"cDL1H1H5}HfSDO H_EuH;[DLH1H5I謤H;[AWAVAUATUSHLvbdHf%fHH9E1AAfDHsI~x"IVD<AHE1H9uDEtlMd H諺L!IIH5H1ģH1[]A\A]A^A_AFƒtm <t9f.H[]A\A]A^A_@EuHH(1LG1ɺH5uH@AN1LCG1ɺH5HHAFAFafAWAVA(AUAATUSHH=4HH(H HIHH/L @DAEH=G D @uIHHI;HHD$ 8/H@D$ Hut$ HLIwLGHD$Ht$ H}-^HEHL$ H0LcDHsar/LF10H5F蛡LK1L+GH5FsLkL?1ɺ1H5|FGL1=H(H[]A\A]A^A_DD HEHL0LHH HHkL"EHH_H5nDHCHmHC(1C !@LD}H5+DLfL<1ɺ1H5C1轞{LY<1ɺg1H5C菞"f.L)<1ɺ1H5C_f.L;1ɺ1H5dC/f.1D$ L;1ɺH5!CL|@SDO HEuH[fDLC1=H5!D蜝H[鳏SHH $HdH%(H$1Ht8u*H$dH3%(HĠ[f.H$H1HxHϠxHH޿u5CLC1ɺM1H5QCǜC^USHH $HdH%(H$1H0Ht8u&H$dH3 %(HĨ[]LC8H$H1HMAII AAA H˟xWHHyH觲LB1IH5LB1Kd1AfL@B1ɺ,1H5B菛ŒDCt"HB0bdHtf@u Hff.S8tq0HHjC HtLAHHH5\AHCHAHC(1ƚH[Ð11LA1ɺ[H5'A蝚H[L981ɺc1H5@of.SDO HEuH[ffDLA1H5AH[3t DATUHSHbdt01HHStbt x[]A\HXL1tH50?$fSDO HEuH[&fDL?1'H5?ܔH[SHHӃbdlu [H`L>IH5d?1y1҃Kd[ff.@S8tq0BHH@C HIL?HHH5>HCHHC(1H[fD11L]>1ɺ2H5>轓H[Li>17H5u>茓f.SDO HEuH[醅fDLd>19H5i?<H[St DATHUSHӃbdu[]A\fDu>H薩LB>+IH5>1诒Kd1[]A\@HL0HHFAT.L >UI1H5>\XZHL=$IH5U>1!K` DS0HHtTLHHHTL=HCHPDH5=HC(1C 詑H[@Ly=1CH5=|f.SDO HEuH[vfDL=1)H5>,H[CUHSHHHnǧHS8cdHl$tH[]@HI1RLH=H5=謐XZKdH[]f.U0HSHtHHt\HELV=HkH=HHCH.H5=HC(1C HH[]L<13H5<f.SDO HEuH{H[݁DL<1oH5=蔏fAUATUSHH(Hz8dH%(HD$1HFHD(D`D$ bd^t~1ARE!AHT$ HPCŅuJSdL$ ЀtЀ CdH誥L=_IH5<1Î'Ht$H;t?ZH;D$HL$dH3 %(H([]A\A]fH(L;"IH5]<1AKd1fDAA,D fDAA,@D f@AAD f.HxH(L;IH;H5;P1腍XZ=蹄fAU0AATIUSHMHHHC HH?HCHHC( HHD(1Ҿ#LQ1HkL:AH5:1UEɺ賌HH[]A\A]DL!:1{H5:|f.L:1H5f:LH1b~SDO HEuH[F~fDL:1?H5:H[~SHӃbdtaH 1?H1?H9tH;Yu FH9YtBH H9uKdH^8H5j:IL;:1w1[Ð[SHnHt!HXHH=1?[L?H591[fH=0?S0܂HHtTRHHHtL9HCH9H5x9HC(1C 艊H[@L21IH5C9\f.SDO HEuH[V|fDLD91KH59 H[#|ATUSHH $H1dH%(H$1HHHHHH5HHAąuGHHAH$dH3%(DH[]A\H6L8IH581E1Md@Hȟ/L_8IfH訟L8=IH5`81Md@?u#HDbdH8t"Hf.f.SHH$L<8&IH571=K` [ff.@U0HSHHHt\HEL7HkH_HHCH H5R7HC(1C 譇HH[]L/1UH57|f.SDO HEuH[vyfDLd71/H57,H[CyJdJd@tauXBbuRH@uPtJdH蕝Lm7(IH5D71讆1HJdS0|~HHtTBHCHHL7HCH6H56HC(1C )H[@L619H56f.AUATUSHH $HhfLdH%(H$X1H\$PIHIHH*H߾)D$0HD$@MUL1ɺ;1H5a6dI1ɺ<L\6H5?61@I}HD$0H\$0HD$Ht$HGD$P`HHMIHHL$HLHHL11L 6QH55ÄHD$RL 5L5H55HLE11菄Lq1L5ISH5]51cH;H$XdH3%(Hh[]A\A]fDHA4$71IL61ɿH54XZ1L5LH54܃HEHH@PhnfL51BH54蜃wL|$8/E1H-uHD$(L$HD$4HD$ HD$@HD$LMIfK>HLhLLH=t|LtHvnI|H53uR_L]uHt@HT$ HxHD$1H5 >luHL$uL)HQH@v}DLt$8IM9;MLd$(1IHIHCHLLP ŅuM1ɺ[H521cdHI9uID$LH@PhHL$8dH3 %(HH[]A\A]A^A_@M1ɺ`H51d`fDL11NH5cL 11SH5|cID$LH@PhMZATUSHH $H1dH%(H$1HHHpHxHHHILHLHHH1fx>HHLH$dH3%(u\H[]A\LI11ۺH5bLY1ɺ1H5a1bYfDUSHHHHxt{HSHEHHx׶ÅHEHHx[uX8HiÅH[]ÐPLH5JH11aH[]f1L1ɺH5QzaH[]ÐLL1H5EaLT1ɺ1H51 apff.SHH?Ht[fH[WATUSHH $HHdH%(H$1HHHx ^rHHLHMHHHH1d&PHH;HAHH=@(9C(iDO1HG'Ho1H-HMu)Lr1ɺH5w_f.H$dH3%(H[]A\Du1L1ɺvH5 N_HfHH1LH5HLH1_XZ`L1ɺH5^@DNLq1ɺ1H5y^fHuhH{h3DsNH[nUHHw jPHSLHHkH5.1(^[AUIATIUHSHHHdH%(HD$1-P1҅Ict$0H|$NHGHHfH HH9uD4It$bRI|$LHھ PHtE<\I<$4nVHt)H1H<YJI,$#[]A\f1LH5[[1]A\DUSHHGP;Ww(HS CHSCH[]ÐHwHŅt CL1ɺ1H5SO[ff.fG00NG0G0G0PW0tfDH0ff.@g(fSHIкH sdH%(HD$1I)H{o$HAHHD$@Lx CP;Sv1HsH{Åt>HT$dH3%(uuH [ÐCHUÅt7L1ɺ1H5ZDL1ɺ1H5YyQff.fAUATUHSHH(H$L$L$t@)$)$)$)$)$)$)$)$dH%(HD$h1HfH*Y f/H>H OfHHtHHYf/wLd$ @H#L\1~FLl$fDLHLHH$PD$HD$HD$pD$ 0HD$S tH|$hdH3<%(u?H([]A\A]HfHH H*XH yEiOfAUIATUSHHHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1IH-$LLHH$D$0HHD$HD$ HD$S tHT$dH3%(uH[]A\A]NAUIATIUSHHHL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1Hf$HLLH$D$0HHD$HD$ HD$S tHT$dH3%(uH[]A\A]MAUATUSHHT$HuH[]A\A]f.IILHH5yLHbNH|$xPHtHuH{HH*PHuLD$HLLH31ÅrLg1ɺ1H5UQATIUSHHHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1HfH$1HLHD$HD$ H$D$0HD$S tHT$dH3%(u H[]A\KfDH1HH5AVAUATUSHH $HHIIIdH%(H$1HAD3HH5L1ÅtrMDH 3ÅHH5oL1\ÅH$dH3 %(H[]A\A]A^@LY1ɺo1H5SDL/1ɺnH5k1eSL 1ɺr1H5C?S]f.L1ɺs1H5S-EJDUHAWI1AVIAULmATISHdH%(HE1NLHE @H=H5 LH1H5L1ÅBH5L1ÅLjÅLXYHHHH%H)HHH9tHH$H9uH|$LH\H5LH1SÅ1LÅH4MCH5a LPHAPL~LHH=L1XZIHt :7L>HUH5&LH1ÅU'fDL1ɺX1H5#QHMdH3 %(He[A\A]A^A_]L1ɺWH51PLy1ɺZ1H5PDLQ1ɺ]1H5PcfL)1ɺY1H5c_P;f.H)HL:fH5 L1ÅL1ɺc1H5PL1ɺd1H5 OfLy1ɺ^1H5 Of.LI1ɺa1H5 O[FDAWAVAUATUSHH8H|$HdH%(HD$(1t)HT$(dH3%(H8[]A\A]A^A_@HD$L#L9E1fDI|$AM$$MlLl$L9uI}H|$e?IHD$ HLl$Ld$ 1HdLL覼L;L9fIO1H"LLxM?L91H>LLPuL1ɺH5 NL5@L11H5 ML1ɺ1H5 MfD1HcLLĻH|$LH1H5o ŅtAL?>L1ɺH5P QM/@L`?L11H5# Mf.7fDL1ɺH5 L@L1H5 LLQ1ɺ1H5 LeCff.fAWAVAUATUSHH $H8LnXdH%(H$(1HHAHUHH5 H1AąC0H} {0NC0L$ LC0AąLH5 H1-AąALHAąrHH Aą0HHHHtH5X H1AąX}`t$;cH5@ HH1AąHEhHt HPH5- H1^AąUpH5# H1.AąL\1ɺ1H5J$AL611H5plJH$(dH3 %(DH8[]A\A]A^A_L1ɺ1H5#JDL1ɺ1H5IDH}P:II5)fDUtUxxFH5% H1Aąu.LG1ɺ1H5}I HHHD$H5H߉1AąHFAąqHC0LHD$L9l$xHD$ AHD$S1DH5HTtC0{0HNC0H5aC0AU 1#AE$AHKHHH1pHhAM(t&AHHH1zIEHL$H5 HHP(1IHIEH@ H@HtHLЅC0PS0?1H5EH2MmEL9l$IEH|$EgLuPHPX,L*1ɺWH5abGL 1ɺ1H5EE1>GfL1ɺ1H5Gf.L1ɺ1H5Fnf.H54H1/AąL]1ɺ1H5F"fDL11ɺ1H5kgFfL 1ɺ1H5C?Ff.L1ɺ1H5Ff.L1ɺ\H5Ez@ALH5H`AąUHH5H1 Aą2L;1ɺ1H5uqE@L1ɺYH5HIE@L1ɺ1H5#Ef.L1ɺ^H5D@H%H5.H1AąLn1ɺ1H5D3C0PS0&H5H1AąAL 1ɺ1H5C?Df.L1ɺdH5D@L1ɺ_H5C@L1ɺ1H5CNLc1ɺ 1H5C(H|$:L.1ɺgH5efCH|$L1ɺbH523CL1ɺnH5CL1ɺkH5BL1ɺ1H5BT9ff.AWAVAUATUSHH $HH $H8dH%(H$( 1IH5RHHC0HD$C0C0MIHL$L9PLd$ Im LHH{L虳IHHA1LH5H6C0{0LNC0H5H߉C01HH3H=HLHLH5PHH1+HKHu@I>臡Hu@I>HD$֡HT$IHt:Ht51H5Hc"1LH5HGHH+3HH4<H1HHH9H1H5H9AHHHH1d,HHtHBC0PS01H5sH`MmL;l$C0PS0u H|$r1H54H!AfDC0MIHD$L9OC0@H|$XfM1LbH5-)?L11H5 ?E1H$( dH3 %(D~H8 []A\A]A^A_f1H5H/3H1HHHD$L91ɺED$L%1ɺH5a1[>DL$LD$L1ɺ@DL$L1ɺ!D$L1ɺ"@D$L1ɺ%Li1(H5=E1@D$Le1ɺ-;fD$LE1ɺ.fD$L%1ɺ8fD$L1ɺ;fD$L1ɺ=fD$L1ɺ?fD$L1ɺA{fD$L1ɺI[D$Ln1ɺ3DD$LW1ɺ4-D$L@1ɺMD$L)1ɺD3AVAUATUSHH $HLv`dH%(H$1IIHH~hLLH5HL1kÅ!U(H5OL1MÅHEHfHH8H.L1H50jÅAZLLÅHLÅHHt :+HHH5L1ÅpHHH5L1oÅL1ɺ1H5:#fLy1ɺ1H5:H$dH3 %(H[]A\A]A^fDL'1ɺH5c1]:HL1HnÅH5L1Å;H5L1lÅrEPcHEXHtHPH5L15ÅLH5L1ÅxL91ɺ1H5so9f.HEHH@HAHII5L1ɺ1H58;f.L1ɺ1H58 f.LY1ɺ1H58f.L)1ɺ1H5c_8f.L1ɺ1H53/8{f.H5L1ÅL1ɺ1H570L1ɺ1H57fLY1ɺ1H57f.LÅ}PvOH5{LH1ÅeL1ɺ1H5+'7sL1ɺ1H57ML1ɺ1H56'L1ɺ1H56-ff.AWIAVIH={AUATUSHHT$dH%(H$1eIHs躥IFHIM1Ld$PHl$pL9Ll$L|$YfDI>LiIH@HLI~LH蚧 H $H;\$tuA LL{$H1U9yL:1ɺ1H5tp5L1ɺ1H5S1M5YL|$EF8EIH5L1ÅAF0LLA~0ANF0AF0ÅLÅ=LLÅ(LÅ>IIF0HHD$ ÅL1H5L[AF0AF0wAF0ML9 I|$>tIt$L5M$$L9uML9t,I|$uIt$LuM$$L9uAF0PAV0u H|$ k1H5-LjLK1ɺ6H53L)1ɺ1H5c_3nDIHT$LHAÅ L1ɺ1H53%@L1ɺ1H52I>Ht bII~Ht IFH$dH3 %( H[]A\A]A^A_f.L91ɺ1H5so2{f.L 1ɺH5@A2@L1ɺ1H52fL1ɺ1H51f.L1ɺH51L@La1ɺH51$@L91ɺ1H5so1f.L 1ɺH5@A1@L@ÅIHHD$袧ÅX1H5LgAF0AF0AF0IHH9D$HD$@\$,Ld$HHD$L4$L|$8IHD$@IGLhImpI]pH9E1HE8uH@HxH"MtLt$@HmH9uMUI~H|$@ HH Ht$HD$HHF1LHMupL9ttLl$0MIH\$fIE0uJu 1Ht HLΝIEH@HHLHHH1覝>1MmM9uLl$0Ht$1HpELxH\$pI} (H*zH<$IIUHH<$1H5H $HH5CA0y0HNA0A01WfIUXH<$A(HH5bIU`H<$A(HH5=IEhHt6HPHRHH<$H1HH5IHtH<$1HH5 H $A0PQ0H<$1H5}H M?L9|$WL4$\$,L|$8AF0PAV0u H|$ y1H5;L(AF0PAV0H5L1ÅAF8!}@L1ɺ1H5KG-}fL1ɺ1H5#-Uf.L1ɺ!H5,l@1ML9\$,L4$1ɺyLbH5,HLB1ɺ1H5|x,L!1ɺ1H5[W,cfL1I\$,dH5.L4$&,L>@R1\$,LH5L4$+NL1ɺ+H5+<@La1I\$,XH5L4$+cfH|$ &\$,L4$1ɺ{L I?HT$LHǐ>ÅL1ɺ1H5+L1ɺ2H5*jIHH9T$Ly1ɺ_1I\$,L4$H5*yLH1ɺ1H5~*\$,L4$1ɺLL1ɺh1I\$,L4$H512*\$,L4$1ɺ|L`L1ɺH5)v\$,L4$1ɺL!H<$1H5`1c\$,L4$1ɺLSLG1ɺH5~)\$,L4$1ɺLH|$ 1AF0\$,L4$1ɺLv\$,L4$1ɺL[\$,L4$1ɺL@AF0 HHH5f.AWAVAUATIUHSHHhdH%(HD$X1HH5H1AƅYC0C0At$LE1L-=DI$H @L4LhI|$HBG7HHHXI$HJT2HHHJXHHHHRHHD9LnH5MD1AƅL$1ɺ1H5^Z'5DC0At$LC0HBHxHHt$@Ht$H{Ht$蕘HHiAD$LLmHߍpI$D9H5JD0MDŋH1"AƅzAt$LAD9UC0PS0u H{0/H5x<H1Aƅ\A;I|$@ELPU1H5)E1"&XZH\$XdH3%(DTHh[]A\A]A^A_f.AL11zH5%f.LlJHD9HPHH5MD1AƅL51ɺ1H5ok%FfDL 1ɺH5@A%L1ɺ1H5$E1%L1ɺ|1H5$f.H kHPHHD9H5-ID1*AƅLX1ɺ1H5$ifLL$L1H5[W$I|$>ELPUL1ɺ1H5 $L1ɺ1H5#1E1LH5#UfHSHHXdH%(HD$H1He)D$HD$ HHD$(C)D$0)$HT$D$8uJHHHuHL$HdH3 %(uHX[]ÐH|$VGAUfIATIUHSHHXdH%(HD$H1G4)D$)$@H)D$0HD$ HHD$(Ct$u t$HD$HtHHHLtfD$HT$I$HtT$HL$HdH3 %(uIHX[]A\A]ùL8H5 "1f.H|$1-ff.fU1H5y7HSHdH%(HD$1HH$Ht5H<$HHtTH<$HL$dH3 %(HuqH[]ÐLL1۹UH5IE!LL 1ZH5!H<$,|BfAWAVMAUATUSHH|$H4$w^taLr1H59 LN1ɺH51E1 HD[]A\A]A^A_H=ILd$1HT6LLU HHLtXHI!9kuMH HtEu HLLADž&H HELL1ADž1HHSHuH5LL1ADžAMLq1ɺ1H5 wfH9=@ILd$HU51LLH2=MLټ1ɺLƼ1ɺ1H5vL1ɺ1H5jPLz1ɺ1H5D*ff.AWAVAUAATUSHH(H|$t$ ?t_%L1H5D1L1ɺH5#1H([]A\A]A^A_L5=HD$fD|$ IFHtBM1El$tL{HLEHH@M$ID$Huʃ|$ L{H=WLHL$H[H_1LH5#H(1[]A\A]A^A_fL{ H=LuAHtZA I$H T$|$ mH5L PQHA7L{1MLBH5k1CHD$HT$H H([]A\A]A^A_L5l=,L5 = ff.AWAVAUIHATUSH(Ht$+HHD$HHzH=HD$HH+HE1HtL`E1AFIH@LH5k 8 LKH p,HLH5A9HDH1PH5P1RXH []A\ff.AVAUATUSHH $HHjdH%(H$1IÅt8Lm/L M$HHXIDLHP u4H$dH3 %(MH[]A\A]A^fDLL)HH=IHڹLL8I<L H 1AVLMLH5^Y^WwÅt)L1ɺ1H5m0/H}L\ 8LhPH5"1AVLMXLZ#`fDHLM1AT1ۺH5_AX ff.AVIAUATIUHSHH dH%(HD$1HL$HT$IMHHLMtLLv uRH1MUL H53XZHt$dH34%(HH []A\A]A^AH1#H1ATIH5LY^띐HL(M1UH5d_AXh ATLaUHSHIT$HHHtHH` []A\@I$HH[]A\DHAHHHjf.AVL 1ɿAU1ATIUSLnHӺ$HnH5HIAUA[A^HHH~LH詁HLL9bAUNt-1LjUM>H5u16HAYAZL9"It$hJ<6H9`ID$pHHLH1LHIHt#LH)J<6H9RHHL)HHHH1ɺbPL1LhH5kH AT$|AD$xHHHDH;LIT$HtJH[]A\A]A^@HXAULUI51H5 X1Z[]A\A]A^ÐHC`1Ҿ,Hx<,HcHIL#11*H5y@HHH1ɺsPL1H5xL4ID$hY^HIL$`IT$pHt H4H9I9L)H9HHIDHrfAD$xvqfHHL'I1H5[1]A\A]A^fDLHH1PL1LmfH5l4_AX@H耓yLIsHXBLGIKH0HIHC`HxY+HŋHHHtHC`Hx-+ATL7IUHDSHHPHtzH{haH[XUH8SH9?HHt1oEoMHoU P HE0HC0HH[]DL1H5 f.AWAVIAUMATIUSHHH>L:I$H AWI1H5LQ\ I4$I>HA_X襸L{ϦLD$G9D$H{(HC(t@HH8uH5A%r0N*>I3WH LVM2 x[H3CH M<${uoL9{u)AE!AmH[]A\A]A^A_I>X#AWLK1P1LH5p AEZY fDI>#AWDKPH5x1ɺL10 ^AM@M<$_L9{RvfDI$I>HT$"HT$D 1LFH5RP1 AZAMA[fDI>x"H1ɺAWI1L/H5 AM {AXM<$AYfI>I$$"HLtSI1H5u8 []1AMH[]A\A]A^A_foATIUHHrSHz(HBBHjtHB(DHH8uϦEHLLHٺH苽Lt_[]A\DK!LIH51d [1]A\ff.fUfSH8dH%(HD$(1)$)D$D$ wAooWAHHh 1) $)T$9HL$(dH3 %(uIH8[]fHG`H@Hh8 AL(UH5P1 X1Zff.H2fAVAUATUSHH $HH $H HjH]dH%(H$ 1IH߾/-HH)H=L$HPHL^I$Ll$HL$ LLLGNÅ|$ H5)IH;H 01AUM$LH5Hu_LAXLÅU|$ t8HÉxHuLYÅHu MLnCH5;1HuL0Y^+L1%H5H$ dH3 %(H []A\A]A^LY11ۺH5bL 1ɺA1H5|?1A.L$fD$@1ML23H5!L!th8|$MH dHHDHLPH/H5P1R5H @H-HU8IK|$HMHEHPHBL&PH5Z1R*H |$ A<$|$MLHDH,PHhPS@LML-_L%LLA9H5IEHPHP1R:tH L!;ILML@<A9MDHPHPATH5Y11H [8FMLYP1H5uXZDAWfIAVAUATUHSHHHzpdH%(H$1HBh)D$@)D$PD$`)D$p)$Ƅ$HD$ueHLKpHtoxh)|$poxx)$o oSHD$pH|$pLd$@HK@HD)L$@HL)T$XIw0LjjPH HHXHLHHHD$(=H{ o+osA),$A)t$L|$E1H\$ LH|$D HIHtyLxMoIGI?H I HD$AUL t$I1H5I XLZBIOIWE1I7AH AH\$ HL|$HBAŅHH\AŅaHT$0H5UHH\$8L|$0AŅhHHAՈDAHDEHDH{@Ht$(AŅtA}@o[ oc0A)$A)d$wfDAvDLKpAo)\$pAoa)$Li1ɺ1H5H$dH3 %(DHĨ[]A\A]A^A_L1ɺ}1H5E1Lf.L1ɺ1H5\{f.L1ɺ1H5,Kf.1ɺALzH5fLY1ɺ1H5DAWfAVAUIATIULSHLvh$DL$dH%(H$1)D$0)D$@D$P)vA} D$AoM AoU0)L$0)T$@Ht$0ٺ LIMH Ht$ MH I HD$II H HD$IHD$(LHtL=u<$H H|$t L+|$H _M9L覃HALP H5Y1YE1^H$dH3%(DtHĘ[]A\A]A^A_f $MA ȅH "M9[$I9s $LL)MI)M9LML)LH $̂HL AWHL$IH5~1Q1U;H AHD$tD$H9HAI}@LLFD$L[D$?IE`HD$L`hIEhHxA2D$HIIEh8D$Hx2D$HIT$IGfLAG t$IWIU@LpHHhH@H@0@ D$I}hALAomAouHT$` Ƅ$)l$`)t$pD$fAo]Aoe)\$0)d$@Il$8L4AٹL]UPfAH HIHH HDLEHt$  L Ht H@HH|$MH ~HL$ A rIHL$ H9rHct$L1HHH)HLELT$I4.MH1H|$(IH HHtHI>L9I4.I94$LL)H|$H?H9cH)1I4.HHHt HH)I4.L9$H H|$IIID$EL$eHALPH51AXAYD$@H|$HtL1HHtHI9{I)M9MCHChfHt$ 1ɺ L,HH@HL@L@H MHD$HIH L9vK$LL)LfM *I)KL9SHq1LHt$H#$I4.}@LxH MIz@L}ATLAVI H51m_E1AXMfH AfDCoHIL PH5N1AYAZH LA1H5L1ɺ 1H5E1LH5ɼLLf.AWAVIAUIATUSHHHHnhdH%(HD$81~ D$0oF oN0)D$)L$ ILd$HAdž L袪HtSHPHtJHrHHt$LAstoLD$ELLI tJHtH詄H\$8dH3%(HH[]A\A]A^A_fL{L IH5`1!1Doo^)T$)\$ L|LH H萩HtH@Ht H@H HI):fDAWAVAUATIUHSHH8LnhdH%(HD$(1~ D$ ZoF oN0)$)L$M9l$tH1I LLIHtI|$ LըHt_Hs@HSH1EwIH9HH螴ŅLLIŅ@L LSE1HtH@HtLhI It$HHHuqA$tvHHILDHL$(dH3 %(H8[]A\A]A^A_oo^)$)\$uA$tH+1L)HH9xH1yLIH51:f.ID$LHxoHI|$A LHfLّ1ɺ1H5Lf.L1ɺ1H5f.I<$gHHxHLUI1H5ͷ1XZGL01ɺ1H5f!ff.vSHH@HtfcH{[#ff.HSH@Hxt [L11ɺbH5[fUSH>tH[]HFPHHHphzŅuHCPHLH5LsH1AXZff.ftMATUSHHv@Ht2HH1uIHH<vgLOt[]A\Ðf.H{@wLP1ɺIH5ҵ1Ef.H{@7L1ɺIH51SE`HuL\IH5P114f.AWAVAUATUHSH覈HHbHxDeH%HHCHA H{H#%IHGLuH>L{ID$MM.H5LxHHtLIDH92L]!HHaLL#HEHIvHL#HEH;IvHL#HEHIl$E111AD$ LHHC@荧(tLmHm_HC@HyAucHH[]A\A]A^A_ÐLLHp| HHHD$MH ʹH1~LL$LM)HLfHlHHvL1ɺsH5RDLUH5H{1LL11 H5DL!1ɺ 1H5WfL1ɺ]1H5l/|f.H5*@MLYiH5(8fD1fLy1ɺ.1H5f.HoM1UL"H5yXZfL1ɺ1H5QHL1tLe1FH5] FML11)H5'f.L1ɺ?H5kLe1ɺ;H5հGLA1ɺ61H5w!fHGH@HHtHf.SHGHXHHtcH;RHHC[ÐGDGƒE‰GAUIATIUSHHjdH%(HD$1HGD$H@HxH1HULD$HHHHC(LHC0C8衠H{(FHuH}HHC@HCHCPŅHL$dH3 %(H[]A\A]H}Lл1ɺIH5 1FfDLy11H5׮uDIEHH@HxL1H5X3ff.UH@SHHZdH%(H$1HHHHHCHD$ :H}(HsH;Ht'H$dH3 %(u7H[]LW1ɺPH5̭1fDAVAAUMATIUHSHGHxvHHtFHUMDHHtH[]A\A]A^fID$H1Hx=L1H5!AMff.fAWAVAUIATUSH8HiHH4$dH%(HD$(1HD$$H9t.IHPIEHuH;r@uCHPH9r@t6HH9uH|$(dH3<%(H8[]A\A]A^A_@AU AMDLD$$HI?HHHC(HHD$H{(HE(Ht$HM U0Et HK@HCHSP"HK(HC0S8HC@HCHCPL֜H|$zLœHLEH}H HDLD$HT$H}(HT$LH At$(LެIEERLD$MDӺYAPL_P1VH57Q ARM$LT$@H0H5H}(LzHK@HS0LTLDHC(sHH5Q RbP1ASLT$8ARM$H0L輛H|$`HuH}H@ŅEH$@LDH{0;HC(HC0C8HC@HCHCPL1ɺ1H51qIHH@HxLж1iH5ȩ5HLHJI9t'L@LM9P@u&fDL@M9P@tHL9uHGHHA(HHE1HH?ff.@HHwHHHE1HHHwHHHAHAWAVIAUATIUSHHxHjLoHdH%(H$h1D$THEH}HD$XHD$$HH$HH9t'HPH}H;z@uMDHPH9z@t>HH9uH$hdH3 %( Hx[]A\A]A^A_AT$ AL$DLD$THI~OIHIEHvHD$XAEEu D$PAED$8HID$ LLnHL$H5HTRPC(Q t$ P1TID$ H0H-HH-I9I|$( AID$(It$0M|$ HHD$H Ht$(HL$HD$ AHD$(HD$D$?O.C(LM9|HLm MzLLu( H5Ħt$(t$8t$(t$8P1tC(H(LjL AVH5}AWAUP19H0S(LH|$ L;l$mM9dLl$L_ KD.H5PDx1AVAAURkH E LLD)H5ХRN<2KD=T$PH)кPC(P1sD$pH DT$L9}H}Ht$It$ 蚒C(j AWLH5^AULP1H H}LHL$XLݓaH}謓D$8E0M|$ D$?AHD$ HD$(HD$HD$M9MBL;|$HLt$0ID$ H-PAVt$ RNH51VH0H1"C0HLt$`HLBK0YLHͥLLHL$PHT$XHIH<H|$XH.D$PI}Eu AE~IHH{HHsH;LLHCHH{H{HHt$XDϦ;D$8AEfDPC(LAVLH5vt$P12H HL9HHD$?HL$HD$ L+|$K(LI/HIŁtH)HL,RxLAUH5P1Q M|$ H IL9C(HLLh AUPH51AKM|$ H mLLLT$HHL)L)HLHt$HH5<HL$8Q RAVAUP1C(H(Lm Lu( Lt$(L!H5t$8t$(t$8P1C(H(Lt$8L3 AVH5t$XAUP1bH0S(L|$?LT$HH|$ HD$Ht$H9D$@H9I9zHD$Ht$0M)HMLHIHHD$(HDPHL$ ADT$PKD=VH5Q P1AWAURtH@DT$E LD)LAHD$0H5D\$(MHD$ LT$ LASPL)L\$ PC(P1)L\$0D$pH LT$ MI9L9L9rrHLPC(LARAWt$ PaHL1tLLw1}H5-|$?M9L;|$L;l$CL)D$?HHD$ HHL$$D$PM1E1HD$0HD$Lx1ɺ1H5#Lx1ɺa1H5iHL8ehPQ 6D$PLT$0I9H}Ht$LT$It$ 辋LT$C(Lװ LH5zARLT$AWAUP1/H H}LHL$XLLT$vM HC( LARL|$(H5LLT$AWP1H H}LHL$XLT$L+t$0LL{L $LkH5mPD$0LL#H5rPC(ARAWt$ P1+$H0LT$0I9 LLږ1H5"HLPC(LARH5AWt$ P1$H0nL $1LH5lfAWAVIAUMATEUHSH8HH4$T$pLD$HHL$1dH%(HD$(1D$HHLx(HP(Et%H@HHtHK@H9tL{@LEHfDHC0E1LEHH AHK L 1I9v <))<HL$ HEQHL$ QAOQHH5>V1QLWLPD$HT$H H@H}HHtqM LPH5[1t$AwAQLMH Eu}HT$(dH3%(H?H8[]A\A]A^A_AEM LPH5ޚ1t$AwAQLMH HK` vL1.H PLL$1L]H5x@ZY4fH}HH5OPLL$1L^_fM1ɺPLH51t$AwAQLMH f.HHHHHP@ LMAPHff.AWAVAUATIHULLE1SHLIHC LkLP^_IHu HtMtHL[]A\A]A^A_Im1E1HH(VC HAIAH1AUILO1H5٘XHZM1L\IH51iMt,s<LKE111HL肇3DHLP1ɺIH5K1 f.AWAVAUATUSHLl$PHHIHMMMtHB H-HH-H IEHE(HH}0U8HF0L$ V8Hu L8AT$TI|$X)I9GLL$ IFHu(1I<$DE0AT@HƃWHI65>A)LSLH ÅI<$BÅI>M<$Le0H](I^H L3AWI*ATH51SH Mt1HE HM0H-HH-HH)H H9HBIEH[]A\A]A^A_I>Hm(InH1ɺUIL"1H5\XZI>I^H H5/SILa11AL$dY^eI>La1ɺIH51L11ۺH5rDI>Hm(InH1ɺ"IULr ff.fAUATUHpSH(dH%(HD$1HHHhHv>HCHHC8HzHC@HނHCHCXͩXHoH Xx>L-w>HChHLc LhL*FLL/FH7WHC0HbHhHSHHH='HCPHZHCHHH$HD$HD$HUH{PHLK81ɺU L\H51HL$dH3 %(H1H([]A\A]f.LE H5ƓH{0HP(H1L1$ H5LkLy3 H5VH143LԨ@ H5]Ll1ɺK H58@Lal1ɺQ H5ђff.@UH1SHHrR dH%(HD$1H`LD$D$H^Hte@8HHHH@(H@0H@@H@H@PÅt[HL$dH3 %(uxH[]DH1Li IH5ޑ1DHPLܧx IH51ivf.DHG?HTBHEB+BHfDAWMAVAAUEATIUHSH5BH|$u11-eHHHHH LhID$X;H5=P1AUATHEMjD$pLDHHPH$@TPt$xD$xPUlH0AŅ6D$`HCBH--{H[CHb1HHHIT$HxHBh%HpL6HD$Hu_rf.HpHBHK1HHHteHLHKtSHD$H@HD$H8tH<AVLLP1H5FXZE1MHL$dH3 %(DFH([]A\A]A^A_f.HT$H5l<L\aADžHD$8Ll$Mg@HH;;AVLPLL$(H51胿H LHE1<@A-DH:AVLLAPbH51#AXAYf.H:AVLLɝP[H5w1E1ؾ^_HLq4@H11H@HHH:AVLPLL$(HD$HLLHAVH9AVLLqPjH9AVLLڝP{ H9AVLLkPoff.AUATUSHt?IIH@uAHsL]LLHOŅtYH[HuH[]A\A]fD1L1H5̙2H[]A\A]D1LZ1ɺH5H[]A\A]fAWAVIHAUMATIUSHHH$H$HD$dH%(HD$81HD$(HHLHADžHuLAHCHH<H LIwIH5ј15HmH(Ht$0H6ADžKHD$0H5s H5HD$0HCXH5zHo^ADž4H5HU^L|$H5=HLv\tHt$LeHHaLH5-=HC\C`LH5H"\tWHH LfPLL$ 1H5Y^Ht$L4nHChHHSpH58HZ AXCpHT$H5 >H.\tHT$HLADžCHsHH|$HZ,ADžHT$(HtHt$ HXgADž-HeyADžH{HH5JHIXHpLלIH51#fLW1ɺr1H5iϹHL$8dH3 %(DHH[]A\A]A^A_fHT$(H5|xHYADžHT$ H5H=ZADžHL֚IH5ϕ13_fD1ɺuE1LVH52LV1ɺo1H5yE1ܸCp]Cp; LIH5 1脸HkX(IXHAywHsHH=sH LfIH51HkX7I`2HE1L{IH5j1ηfHHL̘IH5-1葷@H|$C`HH1PLL$ 1LAH5Փ@C`_AXLT1ɺ1H5;f.HLDIH5m1Ѷ@LqT1ɺ1H5A觶fH(LLIH5 1q@Cp@HLܘIH5Œ1)U1ɺE1LSH5.HE1HLBPLL$ 1H5^ĵXZUHH5ŒSHH?DSHH@ Ht8t=L Ӓ11LƘ7H5PH[]HpH=tÀۅuH}H50SRHH@ HtuHxu 17L `L)H5R轴H[]@L ֑L1۹7H5腴07L L×H5WfUHHH5TQSHdH%(HD$1HTt1H4$H=ÅtOHL$dH3 %(u^H[]ÐL1wH5dʳLy1|H56蜳ժDAWHAVAUMATUSHHHH4$(L$L$dH%(HD$81HHHIHEHvI4$LH$ADžMd$MLLADžAIHIFpHAoEhILAFxAoMxAADžH5]LUt!IH5CLRADž`L|$ H5bLL SLH5AOLRLH5P3LRIH5"wL'RADžIH52LvQADžHT$0H52LHD$(HD$0QHT$(H52LQL|$0MH|$(ML&I&HT$H54LRtHT$LHdADžALHAdžIdžAH$IF`GADžAAHLAAI+LQN1ɺ1H5!E1脰HL$8dH3 %(DpHH[]A\A]A^A_fDLN1ɺ1H5ь7DL1H5 f.1E1LH5sٯP@Ly1H5F謯#1ɺE1L:MH5~fHT$(HLE13LIH5̋10L1H5{Ht$ HIFPHLH5Q輮Ht$ HsIFHHeLH5 t>Ht$ H+IFXHQL’H5,*L!1H5sLɑ1H5f̭CLiK1ɺ*1H59蟭LHT$1HT$ H5 IL1RAW^HD$@IHD$8IY^IL1HLSI1H5XZy8AWIAVAUATUSHxH$H$H|$Ht$(H$LD$HuHD$ dH%(HD$h16H}LuMpHx LH!ŅHCPLE1Lt$0o@hoHxHD$HHD$K#HSXt AEHmHxH} uLeD$DM$HT$H5LLKHT$LH5.L|KHT$PH5։L`KuD$PHT$TH5 L@KuD$THHT$`LH5fHD$`4LHt$`LIHH{XHH|$LeHLLHD$89LT$8IB H@ HtHt$DLLT$8D$LAzt$TT$DHE1LjjjjVHPRjjD$$覨HPHHH@H@ H@(HtHHL$8HT$ LHL$8HT$XH5-LHL$8KHL$8HHH9tQ 9P v9P wHH9uA$HHL$8HL$8HAHSXH@ĀtHH HSXt΀HSXtHH HSX t HHSXqALHLIH51QHL$hdH3 %(VHx[]A\A]A^A_@HsHLMLH5_AXLF1ɺ71H5qרLyF1ɺ1H5I1譨WLt$0HT$`H5L7HD;l$`1HzHJHL$ILctHHCXqHsHLMH5LY^@L؅1H5N货LKHJ1LH5耧HLIH51IL@L<H5!fL11H5DL1=H5V輦HSxH53LMFŅsH5LI<HD$HP StKxHt$(H|$/HL1ɺIH51$HCtLML%11H5{LKHLDH5T躥DLь1H5&茥HT$XHLHL$8/HCPHLˌH5ρLsH1)XZ*fH訿LqDIH51fDLB1ɺRH5^ɤ@)L׉LT$8L$Lt$TT$DLT$8HHHL$80HL$8fDLB1ɺ1H5ORf.HStH5pLCStDƀH'H8HSXefDLA1ɺH5^ɣ@LiA1ɺH56衣@LAA1ɺXH5y@L1H5LOHϽLЋ1ɺIH51H@H5QHxHHSXHlH@HSX\ AWAVAUATUSHXH)Ht$HT$dH%(HD$H1H8IHmH#H} uHULH='YHHVHC;HD$IH]IHHmHT$0H5;HBtHt$0LHCHGL|$(H5#HLBtHt$(H|$HHXLH5#HBH{hHRHS(H5$H7AaHt$@H HT$8H5vH!BYHD$@H5 HC`HH5D#H@HH5hH@HH5QH@LH5"HALH5 HAtTH 1LL$8LH5 }xY^Ht$(LSHCXHHLH5~H?u ǃLjL L~LAVATUjSHL$8HT$@Ht$HtH0wHT$ H52#HTAtHT$ H|$H UjL LK~LAVATUjSHL$8HT$@Ht$HH04jL ~L~LAVATUjSHL$8HT$@Ht$HH0'jL SL}LAVATUjSHL$8HT$@Ht$HH0jL L}LAVATUjSHL$8HT$@Ht$HRH0 H+LLHD$HtVHH!NIHt$(H|$YHHfLLH16HL$HdH3 %(H8HX[]A\A]A^A_H5HD$@sLLH5zHt$8H|$HHLՇH5Dz话:f.LL"1mH5zuL11ۺ)H5yJyLLH5yL:1ɺ.1H5yL 17H5gy͜hH|$(.CPH1ɺLL$8LiH5y腜CP_AXL1@H5xRL LLuH5xLLwH5xyLLyH5ZxKHLLL$@IH5x芛AYAZLLH5wXLLH5w*LL-H5wLLGH5hwΚYLLQH5:w蠚+LLsH5 wrLL H5vDHLqLL$8H5vXZBfAWHAVAUMATUHSH(dH%(HD$1Ld$`FHHH-HCH`HIHGH{LoPHpI4$L{H0IGHHM|$MHCLHx AHCEEHPPH53LoBhoJxHT$H9tHt$LcHID$HHH5WLZ;t)HT$H5WL8HCHT$HPXH5YL;t)HT$H5YL8HCHT$HP`I^ILA 8fDLq1H5tHHE1>HL$dH3 %(D_H([]A\A]A^A_HLHH1A!LKH5Bt譗XZf1E1L…H5tyf@LɄ1H5sL+L41ɺH5s!@LL$Lτ-H5s@LL$Lׄ5H5[sLe41ɺ(H52s蝖|ӍAWAVIAUATUHSHH5sHHdH%(HD$81Ll$HGH;LL`7~Ht$LHE8HHHuH[HH{ uH3LHEHL{H|$LÅ!foD$foL$ Hu0LEMÅLH5LX6tHt$LGHE@HLH5cL(6tHt$LHEHHHUPH5L4ÅjI~L LjLs11jAWUj_H0ugLs1ɺLH5]qȔFfDH5`Ht$vLM01L!~H5q耔HL$8dH3 %(<HH[]A\A]A^A_LMF1LH5p3뱐La11ۺ&H5p LM81LYH5rpؓSLy11ɺ+1H5Ip1譓(LI11ɺ 1H5pL#11ɺB1H5oYL01ɺ>1H5o3ifAW(HAVMAUIATUSHdH%(HD$1H\$PfHLIMHID$HH[HHHTH5upH5IH5;BHL@3@LH5x/H&3nLH5H 3u`I~hLHL$dH3 %(H[]A\A]A^A_@1L/1ɺDH5ynߑ1H4$LHEXHuL`H56n衑d@Lu1ɺNH5ny@HH5BoH1L+u1ɺRH5m3fDH4$LHEHHLVH5mH4$LHEPHyL[H5:m襐R1L`nIH5m|1N谇AWAVMAUIATIHUSHHJ3IAD$LH?;HHCH[(tcpHSLHJHːsHCHXAD$LH9;HCHHsLFHuID$HsHxPH5HSMLHJH讐sD$ L -1ɺMLLH5k1!E1HD[]A\A]A^A_@MLd19rA@MLT~f.MLd~sMLt~SD$ L%,1ɺ H5j1[DL$ 3LKHjLz~H5jMLDH1AWXE1Zff.HE6>@HHHHWHHPHff.f.HGHNH9uHHHH@H HHBHSH^ HLHLH[Lff.HLVM2 001HfAWAVAUATUSHdH%(H$1HLVM2 001H^HFHo HHWHHC W@HooH$HHD$0KuHL$E1WLH5HH$HC(H$UH$LHH5HHH@H$UL$HI$ID$ID$AD$H$XWLH5HAD$ID$H$UH$HML$HH@H$MuE1I|$ AAHC(H*1H{0)ω)HcHHHO(H0II L|$L-۠E1E11Ll$MM1HD$ Ll$(Ll$UE3H{HHD$@1H$HAHD$8H$H$H$HLT$xMd$ L$tt$pI LD$hL\$`T$XLL$PUHHD$HUH&AUL$ART$hRt$(L$APL{RL$ASt$`t$H$QAWt$xQ $$$$VSHz$VH5z$ $8ATj$XL$I AQI1jS$($虉HAH$dH3 %(H[]A\A]A^A_f.H{PHKHII 1HcHHLB(HR0MI H I L-'LyIHyHT$H H L=yH|$H=yHL$ H HL$(H|$Hs0H HD$@H Ht$8EH3yH$HHH$H$HyH$fDL-E11Ll$MBL=ȝE111HD$ MMHD$L|$(L|$L|$?fDHLT$hL$`LD$XL\$PT$HRHHRHvAULT$pH5mxIHART$XRt$(LD$xAPLyRL$HASt$`t$H$QAWt$xQ $PHw$jPHw$jP1RjjRjjRS$ HuDL$1ɺlH5wنƄ$?@HLT$XL$PLD$HL\$@T$8QHHQHVAULT$`H5MwI1ART$HRt$(LD$hAPLwRL\$pHASt$`t$H$QAWt$xQ $RjjRjjRRjjRjjRS$ HH,QH贜L8wIH5v1ͅ1C}HLVM2 001H9FAWAAVIAUIATIUSHHHnHEHD$1҃{<MHL1ڛHHH@Hz(H$HC(H߉>Hg:H$+HK HMt$ILY^AFdAt>Lu1ɺ1H5uA跄H}56fH}[<$QH1SILv1H57uhA $XZD$HD[]A\A]A^A_AH}LmH1ɺQAUI1LvH5t HEHC(AYA $AZE1H}H]裚HLvSI ^H5t1跃_ANdAAXG@AWAVAUATIUSHDiH|$H$HILAoEAoMdH%(H$1HFƄ$HD$0HD$)$)$AQL 15jAQBH HuIu HHM}(NHZBHBHzBIu(HtIWHIII7HuI1Ll$(E1H$fIHtHIOME1LHIHSuHD$(IH$@<HufDEoEtPA]DHMonMAwHMIwHt"fIUHIpHIuHuMLH\$0虘 LrIH5r1貁1HHH{h<HD$$HLH|$HD$$DŽ$HD$AŅE1E1$'H<$&LK H5qILQr11HHH{hHL$H4$HH|$D$$DŽ$4L脗Lt1ɺqIH5qq1蠀LXH5Vq1L`XIr1tH$HD$$HHC@ffDH$dH3%(DH[]A\A]A^A_@Lt$(AF<nfDH<$]HD$$E1H\$0E1HD$L蘖HELRrP H5xp1_EoAXcLXLs1ɺ?IH5Ep1tL,L=W1ɺ@IH5p1HLD$$AF@LHA7H<$EAEE!AEf$uH|$HHv*dL薕Hf1PD$1LrH5wo~XZfDAEDL91ɺ1H5>oE1l~LA LCoIH5n1+~H|$HH)AŅuRLGL$豔Lp1ɺ(IH5n1}D$$D$$LAoH1ɺ4PD$1H5RnLp}Y^-H<$L$Lp1ɺYIH5n17}D$$D$$H $HA@H*ГLp1ɺ+IH5m1|D$$D$$藓Lpp1ɺ\IH5m1|D$$D$$wsff.ATIUHSHHt2 萭HHt`LfHHn[]A\fD lLpHHu1H5l|1fDLpDATIUSHH+H9u 'HHHHmHEI9u[]A\ff.AWAVMAUMATUHSHHLhHIHLLT$`LT$HI?8LBH^IOfID$IL$H(LpLhH@@ H@0HAD$ H9t HHH;)uT@HpH9.tGHH9ut$PL{4LHPH|$XtHT$XL"H[]A\A]A^A_@AD$ DHjLnIHtf8HD$jHLHH5j zLL$Ll1lLn 1H5jyH1[]A\A]A^A_ùLHH5cjy1fATIUSHH+H9u 0HH{kHHHqkHEI9u[]A\UHSH$qHHtH!>HkHHH[]@Lm1H5ixf.jSHpHHtDHM!>L w1ɺ(HC LEH5xm1LK(HC`exH[L 1ɺ"1H5Dm?xf.S =~c= H7tBuXbHH‰޿cHH'CHHtj[@ HsBt`HuLl1ɺH5w}w1sH@A1#LlH5w9w1[DLwH5ww1[f.USHHG`t?kXgC`tnn{TeHCTH[]fDkLlAIH5v1vC`kXgC`uH+LkHIH5v1GvH1[]fDlHߋ(HO1UILv1H5xvvXZ/fUSHH`kt H[]DHH[]lAWAVAUATUSHdH%(H$1HHGaVkX HD$E1L5vHD$ĀOA@L-@DH17iADžku AĀ6HS8H1ɿPLwkH5fuHIUH I%A кP1tH HHH$HlHHhC`3A@M<DHT$ƿ/fHC8x H9D$8HHIH %LjH5t 1R#P1tYD^bE@A@L-tDHS8HLiH5>tHIH I%A кP1s_1AXH$dH3 %(Hĸ[]A\A]A^A_fDDcTH$LHiATI1UH5s:sAY1AZfLhIH5~s1sc`r1JfH蘉LiIH5+s1r1 f.K`DD{TiAătHH=H1ɺ7AWI1L-sATH5rAUOrDcXH 10LrH5rrD`uCT1ch8e2I1PHLDEPH5>r1qXZiAWAVAUATUSHH $HHt$PHHT$XL$HLD$hH|$8dH%(H$1H$HH$H$HHD$0HL hAH5q1qD$LD$dD$`DHICE1H8>_HD$XL0M.LL9%I~G`%G`L|$XgIF1҃ApXHCH8^HH<$HL*IUM9I}G`%G`MIuuI~IVLqH5pHR8PHIH I%A кP1oAYHAZ IFIULH` M9tI}G`%G`_DE1LpH5poL$IMHD$L;<$HD$xHD$ DIL]pIH5o1(oID$`D$LO` H|$xHtaL$HuIGpXH9CH8ILH|$0LsLd$I$ML;$$HD$IGLD$ 11HD$xpXHشCH8] HD$xH$H|$HpHHr`IH_8oXHL?eHIHH UH5vn 1RSmIoDŽ$H HD$Pe`Ht1HHH|$8mLd$@Ll$E11HD$(HD$HLABELONEI9EVEMeI9H*S1H5mATILd1(CmY^HIHuH|$Ld$@Ht$LD$(LL$tHM`H|$8HLH HL$PDT$tHHE芃HI1PLe1H5mlAXAYITLmIH5l1mlD$dD$LfDIuϦA;E#EHKhBL I9I|$HLHuM$$H hBI9ufDH訂H71PI1LcH57lkXZEdID$H\$(AHD$Yf.HHHLbSI"H5k1\k_AX@kL1ɺ|1H5k"kDHЁLb1ɺ-IH5fk1jH|$Xf\$LLcH5 kSD$lPDL$p1jXZHD$hHtHt$0H|$XH$dH3 %(yHĸ[]A\A]A^A_HHLaSI;1H5jjA[X @ˀH1SIH5cjLqb1i^_>H萀La1ɺvIH5&j1iHfƅCfDH81LjIH5i1TiuM`@HLQa1ɺIH5i1 iHfƅ$`@HH=dBlHfATL%dBUH-dBSH]L9t.HfDH}HP(HHZHHL9u[H=dB]A\ATIUSHGHh8HuZHxXHt/L`HHHx_HH=:dB[]A\L a1<H5\hg1L1ɺ^H5;hg[1]A\ff.ATUH-cBSHcBH9t-IHH9t H{L^uHC[]A\[1]A\ÐSHHHHP H[bYfU(HSH$_HHtHhHEHHPHH[]ÐL_h1H5Tgff.ATf11USH0dH%(HD$(1I)$LaH] CAt$L_11t$H5fSZfHT$ H H9wTHD$H9tJHD$A1ɺRHD$L_H5fPP1fHT$ L1.aZYxXHD$(dH3%(H0[]A\c\H1ɋAH5*fL^>P1e^_@+\A8t+L_1ɺY1H5ereuDLI_1ɺW1H5eGeJ}\ff.fH uCH9tHE11QH1ff.fAVIAUIATL%)CUHSI<$t]H]H9u -fHH9t#HCHt@atpXI<$HH9uE11HLL[]A\A]A^@;uDAVIAUIATIUH-CSH}tmII9u>H̀A`L9t-HKA`tqXH}HKHA`̀A`L9uE11LLL"[]A\A]A^@uDHtGauHCSHwXH8H[AWLdAVH5cAUATUSHHxdH%(HD$h1Hl$ Ll$0D$D$/cHLHD$@HH$HD$PHHD$HECH8H#Aą<11xIHLH腡IHt-ZHtLpHH*LLx1L\H5bDbHD$ ILjL H9u"7I$MLI9ILpH1HLHuLLLAtLM~x"1LXIH5b1aL fAƆLAAI$I9afDLd$ I9t'HIT$1HHPM$$I9uLd$0M9t&fDHIT$1HHPM$$M9uL$Ht$HHHT$?<7L<$L H߉E11LHH.HH;\BvuH LLt HH)INLG[1ɺpAH5`1J`M1ɺrLa[H5`1&`fDHt$H.{H|$A.H4$H1HT$nLt$ M&LI9t"fDLMQLM$$H9uLd$@I,$LL;$$t'f.LIQHHmH;<$uLd$0I,$LM9tfLIQHHmL9uHAt$t D$:HL$hdH3 %(DtHx[]A\A]A^A_@HH= Hj LCY1ɺ1H5)_^DL<$HLH|$'LH߉E11LHH,HH;{ZB:H LL1LXpAH5|^1^M1ɺrLYH5X^1]fAąLi1ɺ1H5^]hf.H1L?X|AH5]1d]E11HHHH<$HHD$!!@L^1H5|]]H /f.Lz^1H5$]\uSHH)IfAUIATIUHSHHdH%(HD$1D$H9t%fH{HCHH`H9uHLD$LL\T$1HL$dH3 %(u H[]A\A]1SSE1E11HH0dH%(HD$(1Hpt$uHD$(dH3%(uDH0[D$Hct$ HHH HcH HH qHtHRAT1UH1SlqIHuRfH1HHHPCau%LHHHu[L]A\qfDHfD[]A\ff.SH$CH;tiH;1NH[AUIATIUSH8dH%(HD$(1D$ uRH1HtKHl$LcHHHL1H1LD$ LsHKLT$ 1HT$(dH3%(u H8[]A\A]@QHECH:tfHHf.HtG` tSG`Htt̐H߉C`[@3pL8[1ɺIH5Y1OYHCsXH8MH5C`H߀̐C`[cSG`HtĀt̀H߉C`[<@oLZ1ɺIH5IY1XHCsXH8HC`H߀̀C`[AWAVAUATUSHHDgTJH߉0oHt8/tnCTHHS8LSH5XPCXIIPHAH % кP1XH H[]A\A]A^A_DS`cDkTDsXAAHǺ@1KAŅ8{XO&{T>FK`kXHDkT0nH1ɺAUI1LgTATH5WU>WH 'DCTHHS8LRH5W1PCXIIPHAH % кP1VH DcTDkXDD!HqmAULR1ATIH5V1VAYAZrhfDkXH%mAULRUI H5V1;VYD^DŅL8 JHHlU 1IH1PL[)1H5TVUXZf.΀H߉S`H[]A\A]A^A_@HhlHDLQAUIH5U1}U_AXgDKDsTDkXHD lHLQAVIAUH5U1AT'UH fDHkHDLQIAVc{KD{TDsXHߋ(kH1ɺAWI1LQAVH5%UUTH AVAUATUH-ޚCSHH}HIsXII΅x%MLLRńt1[]A\A]A^fDHsXH}HjAULQATI2H5jT1SXHZ+[]A\A]A^H1jLU#IH5)T1SQf.H1VjAUH5SATILP1+kSY^ @AWAVAUIATUSHH8HT$Ld$LdH%(H$(1HXH1"iHHFL U1H5JSRfHH襑IHt-JHtLpHLJHiHјCH8wLT1H5RSRL|$M9H\$ E1D@HLIoHH^HٺHa1HC HS(I3EI3UH HC0HS8I3EI3UH u{IGHt$HHLl$I]LM9tLICHHL9uH$(dH34%(H8[]A\A]A^A_f.HHM?M9fLR1vH5Q QŅzL1ɺ1H5HQPH1fLIN1H5QPGAUATUSHH $HdH%(H$1HIIHHLg1HٺLmMtAEHLABELONEH9$HLVM2 001H9$MtAEfo$ fo0A$A$H$dH3%(u~H[]A\A]ÉL1ɺH5O1MOL{fL1fL11H5}OOm;Fff.HHыwXHH)CH8qNHCwXH8:Df.UHSHHdH%(HD$1HT$H$D$D $D$AAt.==t/HLK1ɺP@=t4=tiH1ɺPH5cNLK1MY^H)CsXHH8DHD$dH3%(ulH[]@=tHLYK1ɺP1H5M~MXZDL1ɺH5MQMDf.HCwXH8*Df.AVIAUIATUHSHuZL%HCI<$MHtC`t ĀsXx@I<$ILLLńtHI<$?ń[]A\A]A^DK`HsX@H(cAVLKAUI[H5L1=LXHZHk[]A\A]A^HbL]N1ɺGIH5nL1KsXI<$HK`H@HbAVLZJIAUcSH1VbLIAIH5K1oKf.H1bAVH5KAUILI1T+KY^@AVAUATUSHHVdH%(H$1HHxLNHLH HH=@I1I@LLHLL$HHLABELONEH$HD$ PŅIt$Ϧ0Dt$HkLD$aAVLI1UIH5J14JXLZjŅH[LH HYLLHL(L1ɺ1H5/JIH$dH3 %(H[]A\A]A^fDH1jH5I1LiH\IY^ `LK1IH5I1"IfDL_LmKIH5cI1H-@LG11H52IH?AVAAUIATIUSH莪uyH-ӎCH}HtC`t Ā*{XKt%HsXEtCH}ELL0It?H};H߉ń&[]A\A]A^fDH}LLHuH^AULgGATIH50H11GXHZjH[]A\A]A^K`H!H1/^AUH5GATILE1DGY^,DH]LuI1ɺIH5G1 GH}sXH]AULEIATfDH1~]LFIH5G1Ff1DAWAVAUATIUSH(dH%(H$1]LF1ɺzIH5F1,FLD$I$D$1Hl$HD$L-BB1@HIHI HLL.HLABELONEH9D$uEH9\$tiHHuH$dH3 %(D$uH([]A\A]A^A_MuM9uDM6M9tI~HHHtL[H1ɺSIH5E1L9EEY^LLrtnH|$1L?H8H+fL[HLDSIH5E1D_AX@LH[HLDSI1H5D\DXZD$DL[LF}IH5D1DpO;f.DAWAVAUATIUSHH1!HHX IH1fD;u H{5lH[HutqHc;IHt\I] HtOE1f.H[Ht7;uAIcHK1E)LHYIc1A9~ H[AHuM4$H[]A\A]A^A_ff.fUHHSHHdH%(HD$1H$tuxHH VHHHt[HH HHHt>uH{8H*u>HHtH<$u1HT$dH3%(uH[]H*tu9DSH5DHdH%(H$1H|:t81DAu(H$dH3 %(uDHĠ[f.H1ɿHGDLGPH5GD1AXZ8f.u7S=+5uO0uz=[L1ɺk1H5CA[D=71ɿLCDh1H5C@=/t@L|C1ɺb1H5^C[@fDUSHD =EAt11LkC1ɺCH5C`@1H[]H=B1=4Ņxwމ3u-\=H[].t6H BHLCDQU11H5B?XZ1H[]DK6HRBH1RDLBIff.HH5H=BI9HtdH7u01LB1ɺH5AG?HDL1ɺ1H5A?DL1ɺH5A>1Hf.SH5=H=:B8Ht?Hǻ6u[f1LW1ɺH5FA>[1L/1ɺH5Ag>[SH5H=@8HtWHǻz6u[f4H1ɿH@D1LARH5@=XZ[D{4H1ۺH w@D1H5z@QL?A1ɿ=Y^[HH=A.u H4H1ɿH@L"ARD 1H5 @[=XZH@ATH5UHH=?SHdH%(HD$16H1H8HH$c*I.HMHMAHC1+,H8u7H߻5ufHT$dH3%( H[]A\#3HH &?H5.?QD1Lr@.1c<Y^2HH >1QDLT@11H5>#<XZ^@2L?1ɺ#DH5>H1;H=>,ÅHHi>11PDML?1H5U>;_AX2fDAWAVAUATUSHH $HH $HXHt$HH5IH==dH%(H$H!1D$<HD$XD$@D$LD$P4HIL4?11ɺH5=H$L5"?:HEHD$`HD$hHD$pHD$xD$HD$LH=6B(,H+1H=6B#HL=6Btƾ L%0HtLLH=>LH=q>L H=[>L! H=G>L H=7>LL)>LLAAEE1HL$`H=5Bl;HD$`HT$xL=LL$hL\$pHHT$tHL€UMtH==LfMtk1HL$PHT$LLH5u=,uKT$LD$PHHH HH!H H H HH!H H$H|$t8H|$*Hv(HD$x-tHpHD20HHD$ HǹHHt$D$XLML<MPD$\H5:PHP17H L\$ H|$LwD$!DHT$TH5xD$TH=3B*u;D$TL>?1ɺH5:1\7AEL/T$At AEbH$H!dH3%(DHX![]A\A]A^A_fDHT$XHL|$XMtH533BL.]L.>1ɺ1H5[96H|$X(AEL.>LD|$.DT$HE1.HL$HHT$DH5:H=2Bc)DL$DAH1ɿjLB=H58jD$`P15AEH L. @11KIHSD$AϦH$@DLHmtIHqtLHHtLHMtLLHHAH H!%tDDHJHDщ@HHH)oD$AVfD1ҾHIHHH=1B, H1H5I71AWL 0BL<{4Y^AE@L&HT$XHFL|$XMtH50BL}+tL;1ɺ_fDLJDL$L\$ sH1ɺD$PL\9H54PDL$T102_AXAE[)DT$(L61ɺSDH5411DT$= =t NfDATIUSH/H]H9t$HfDۧHH#HHL9u[]A\AWAVAUATUSH@t uE1HD[]A\A]A^A_@HH<$脦 ''116GIHtAH<$LoIHHLpuLGH+IH9uHmH9tH}L'uHttAD$b MI$LLHHD$'fLE1GHUAWL9t$HIH P0H1 I H52RAA 10H @L81ɺ1H52/BAŅnLp1ɺK1H5]2/KL(FH+H9taL%a9ft?t4<-t0L1LLHt[LHHmH9uEJL71ɺ1H51.#f.HEHuAVLw8AWHIH H0I V ȁA1PA Ѻ4H5Q11E1.H T@HEHuAVMAWHIH HI 0V A1A P<DLE1DHULU7P1HIH H0I ARA ɺ1H50-XZff.AWAVAUATUSHH $HXE1dH%(H$H1HD$0@tHu3H$HdH34%(D9HX[]A\A]A^A_葢yAtAL211H5/E1-H5eH=/&IHM1(HD$8'_ʡAŅOH|$8L|$0I8HKMLAH11AL1H1LHWHL$0LL5ӧH1HID1~H|$0DLHHL$0LHt1HID1BH|$0L1HO11ҾH"HH HH1L1DH|$8IHKMLAHB21艠a,E1AϦ+L'cH1H5-EAWL5:1*Y^^AL#t)O!Lx51ɺEDH5T-1*HfDLH=0_$11@HD$HtHD$@E1AϦH$f.Ht$HiIHtLHÒHtLHuAFbtL@L3IH5,1)軞zfDLQ1ɺ81H5>,)wfL8@H<$H5H$ H!%tDDHJHDщ@H$HAH)HcAAF`KI1LHHD$2Ht-HHt HHD$Ht$tf.H59IF8Ht$(IHH IH DI0ҁA A LT$DL$$ ?Ht$(LH1VT$ RDL$4H2LD$ _AXf.LEDH-1TH|$>DLH=,!fLH=,!fLh>L11ɺIH5=*1'?H=*LH1H5*D1VL,H5)/'XZRc@ufS11HL,~H5)&tBu1-H{gtct2[LI1ɺH53)&L!1ɺ[H5)X&L1ɺH5(1&y@L1ɺH5( &?@@ufS11HL+H5}(%ftbtyu1tH{Btv[@L11ɺH5(i%L 1ɺ[H5'@%L1ɺH5'!%c@L1ɺ[H5'$@ufHGt HfD1ɺHLaH5W'$DAWIAVMAUIATIUSHHhdH%(H$X1Hl$0D$,HA$@tx0E1H$XdH3 %(D|Hh[]A\A]A^A_ÐHD$@H5]'HHD$b2eDHD$At0H1ɺH'L)PH5N&1#_AXHT$H5&AHD$DA2uHT$,HH"HDL$,EL11L)~H5%"H#Hru#A$~fDD$L(1ɺ?H5<%1"DL$LfLp(1ɺ11H5%O"A$E11ɉD$L(1IH5$"DL$tuu!DL$HDL$A$fDH1ɺH$H5W$PL'1!Y^-@DL$&DL$tD@1ɉD$L'1XH5$K!DL$u!DL$|DL$A$f1ɺqD$L'H5#1 HHKDL$HDL$Ct]11L'H5E# DL$u!DL$4DL$A$%L$1{TLHHCXHHD$H</@/HHH9D$s&L HD$HL$HZH9uLnHD$HH\$0H9uHH9Ht$HuIEHHD$HT$I9DHxHt~Ld$0HXI9u nfM$$I9tcI|$HzuMtMH|$Ht"A$<-ttI$Iu!H\$H(HL荔A$HD$HHD$I9t!HT$XD$LH%1ɺi HD$H<4HHELƕLA軕SLS)1ATAH5!1TXHZL跕H|$]AIEHHD$HD$HT$I9HD$H3lH|$HD$H2IEHHD$HT$I9hH|$IEHD$HHD$HT$L99H\$xf1wDAUATUSHH $HH=I(dH%(H$1HAÀۅurHIH 4*BIH (L DLzwÅH$dH3%(H[]A\A]@I1IH )BH'L= yH71UL )B1L'H5k'GXZuH21UH5G'L Q)BLU'Y^>fL1ɺ<1H5'DUHSHHHxy1HHFHCH&HCH HC bH=(BHH'to@H=(BYH=(Bo11Yu H[]fH=T(Bu1ۃ8H[]I1Lu&QH5%H[]fDHHH=%tH7Bt#7Bu7Bf.7Bu 7B7BtBH7BSt7Br7Bh7BHt#Ѕt W7Bt[饥Dt߄[鉥fAUAATAUHSH1ҾH1ɺEPH5R%L%6BD-6B6BD%6BP1ATS`H HH=6BxH[]A\A]H=)%H\1ҾH<1ɺEPH5$L>%(6BD-6BD%6B5BP1ATjH 1HH=5BZ1L$H5%$l1D 5BH[]A\A]ff.@5Btf%5Bff.@AWIAVAUIH=#ATUSH(dH%(H$1LÀD4BAELd$LL#yD 4BEt:D4BE=4B54BDt,t1L@趋AfDL谋AH$dH3%(DBH([]A\A]A^A_fDA)3B 3B3Bu\At Da1DLL3BDL 3BJDL@#1H5!#E1D$ M1L"H5!DT$ A tt@D$ 1ɺ1LTH5Q!2BDT$ tlDT$ WNDLDT$ OfA tF11Lk"H5 %DT$ DT$ L!1H5 L0"1H5q  fSHH=s IЃɹEu51H5cHBht-W8u1H z-BHteH=  .BH{H=D-BHtHHc1HQV=H:@HAV=H@-Bu-BH-BHHtHH=8=Cff.@="-BD= -BDSH=,B,BHt&H,BH,BH,B,B[D,BDHu,BH#HHDfDSHHaH[ff.H=+BHt H'~Ht+BHff.@Hc<Hff.H<Hff.AWAVAUATUSHH $HfHt$AAT$ AL̓LD$AdH%(H$1)D$p%)$D$$=F=%D$ u#5A+Bu#AA tME1RZ*BtHt$H=u*BAAenEtEt *BuD-*BH=*BLoMHELL$XL$LD$LL$XHD$hxDI*BEAEH *BHL2H!%tL )BDHrHD։@HL)LMXL;)BMt`L)BIM9sPH)BHt A HAHJI[ tA4$A1 HHK)BDL$EH=(BHL|HYL(BMD!lDD$$Eu YH(BL (BL\$@L(B=(BH(BHT$8D%(BLL$0L5(BLD$(=n(BHD$HL$LD$(LL$0HT$8L\$@|$$H5wHLjATL$ATRHAVL\$@UH0L\$AH 'BH.L\$H=+L\$H(BL'BHuc'BL@H=1'BL\{@Lq'BMD!H'BL$H1MT$ Ht$E]H$dH3%(HĨ[]A\A]A^A_@ B'BL&BME Dd$ExT'BJE1Cw H<oUHELL$XH LD$HH5T$XHD$hEk9D&BED &BEh&B|$p D$pLt$p 3LH=e6BL =L1Hjo]HEHL$XH=.6BHT$\$XHD$h H%BH= 6BHt"H%BH=5BHH%BH9H XH=5B,%Bt7%BoeHEHL$XHT$d$XHD$h E DH=H dI E1[Me]A\A]A^ÐAٹLH5 @Ly11kH5Z E1DHD=L |@AL 1E1dH5 ~IfAL&11}H5 GfH1D=L ff.SH5BHH~u 1[fDH5BSH~tߋSH5BH~~[@AWIAVAUIATUSHHaC=HH9HC=H9HvC=L5' H9"Aą H_D 9t+P1EUL H5 XZDLHsH;BVH;B9H;BIEH[]A\A]A^A_@1L H5 |H1[]A\A]A^A_L5W2Aą8.HML'PH`PHP1H5 H 1H[]A\A]A^A_Ds8A>MH uHH5F HDHLPH4P1RH DSF8_A>MH HEHDHL=PHH5P1R$H D8A>MH HHDHLPHAH5MP1RH L53E19fHiB@HIB@H)B@8TA>H HBHDHMPHFL*PRAUATAUHH=SH(dH%(HD$1~BIHt6HlH01DHH!tvH DNutn^EH H5PHHDaH'BHBHD$dH3%(H([]A\A]H5H= IHQHHL$HT$ 1H5 .L N 1ɺ1L H5mLH=!HHHHB1H5t/IL 11H5tHBHBfIL11H5,yHHIt$DL$H1H=BY^AH-sBfDc8HL PHLPHH5P1H  8d}IH  HJHDHLBPHH5P1R)H 8 L X 1PHL^PH5p1XZL 1ɺ1H5KDBf.=%BufUSH=HHHt/8>t71 H09uH=B0u,BH[]fD1Hx 9~f8=BH HHDHL BPHPLH5U1R4H mfSHLL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1HBHtxAAADHBHtfHBH$IHD$HD$ HD$$(D$0qHBHD$dH3%(u&H[ÐH:=HyH:=Hff.@foBfo BHfoBOW DoD$oL$oT$()CB) LB)UB@H=%B@=BD=BDH=BH5Bff.fH=BH5Bff.f BufHHIjL YH jH=PHRHPHVH5P1aHHff.SH5eH,tSH5hHt;H59Ht#L11H51҉[f.fSH5xHHdH%(HD$1,D$HtgH@ H@XHtZ1HT$HЅtJD$HIٹ 1LH5P.fDLY1ɺ1H5H& HL$dH3 %(HuEH[HYLA11ۺH58HʀtHtHHESHLHt[fDH{ L5IH51@HY[HGH@ t/HB^u'@u"HHsHu4HH@t LuHf LtHDUHSHH5HHquEH[]f.H5~HAuEH[]f.H5AHuEH[]f.1IٹWLuH5W1afUH?SHHHdH%(HD$1蓗Ht~?HH~Ht9H|$HtT$HL$dH3 %(udH[]fDoLTH5>H=HHe=`D@AUATUSHHOHAPL HGH@HHAAuEuOH u^IEt~u2ALu.HCLHphALH[]A\A]ALH[]A\A]fHIHGXH4H Шu2qIDHLTIH5y1 H1[]A\A]ff.HH@@\u f.HHpLtHfL1ɺ1H5Hff.AWAVAUATUSHHLwPHwhI>y1HIHHIHIDL,@pI HL9rM9H[]A\A]A^A_fDHoI>HHzHHD$]I>HH$^HL$LuIH51QHT$R%_I>LAXI>HH$HIH$L`IH51R)AU5AY1AZM9HCPHH8HII>HIAUL<ATI1H5:1XMZLc31H5H1I>IH/LI>HHHH5SIL:17QY^1H[]A\A]A^A_ff.ATUSHGY@uH`ŅtE[]A\Ð1LEIH1H5;[]A\HL%QHt Hx;IH0HPLATI1H5sXZ[]A\f.USHHGY@THCXuH&rHf.HHuQH$rJH'rCt Hu2H蚥u&HuHCXtU uNHHHHlHsHsLmUI1H51wXZH[]@L 1I[1H5:H[]ÐHLcIH5q1ff.@AUVATUHSHw?ukH[]A\A]D N@HI>HI1AUH5ATIL1fY1^?tH@HIHLATI1H5XZ1H[]A\A]AWIAVAUATIUSDHHHH$$HL$L$HD$L$dH%(HD$81AHHD$0蹴1AuIHDILP?IL9LuADžAuH951HHHHP1H@H HDHHH|$0HuHD$0HLAVLL$t$LD$@]AXZEdA6LAHoL1ɺIH51HL$8dH3 %(DHH[]A\A]A^A_DLCLLD$ LT$LT$LD$ AE LD$ LL9LT$LT$LILLT$(HD$QHLD$ 1H5`AP@L1AWLL$(1LT$8EUD_LAXADž`f.LY1ɺ1H5f.L)1ɺ 1H5_f.H51LI1'AufDLE1HH5aPHD$ LLH(1Y^)@HLLD$E1L$YL$LHLGAuLH8HLD$I1H5APLSUSdH 1LH5<LLTLT$ LD$ AEAEAD)AI0AVAUATIUSHHdH%(H$1HGPL(LHID$XH%r L@tLrfHHhH5~iL؜IH<H HLHPHWHfE111LpHHIv?C] uhID$HxhH$dH3 %(HdHĐ[]A\A]A^fDLq1ɺH511IHKH1HfLC1LHL{n[L 1ɺ1H5BEDI$HRhHPh+L~1ɺSDL~1ɺ1H5UfL~1ɺ1H5-f.H16LIH51DAWAVAUATUHSHH(H4$Lt$dH%(HD$1芒HHD$dI@LH AąHT$HBTHH=pL`(LhhH:ÀMUAKH3IB;HE11ATLH5kXZEY=ALJ`HpAąHEPH8Aą* JHLIH5Q1E`EeE1fHHIA1ML H5@H11AU_AX  JCNfDH1H5E1ATL1.Y^EYHL1ɺIH5f1L{1ɺ1H5=HL$dH3 %(DH([]A\A]A^A_fH:A HL1ɺIH51f@H$AALJ`iLz1ɺ1H5};f.HL IH5A1H|$BAąHEPH8+AąHH(LIH51qALJ`H nAą}Ly1ɺ1H5-YLy1ɺ1H5u3=ff.fAWAVAUATUSHH8dH%(HD$(1_HHCXH0H2IHCPE1E11ɺHH8ADžuvHEHG] LNEHCPHkX,HH8hDHHsX,f.Ht$$HADž`HL:ADžfHL`L7LHuADžH@LL0HD$H8HD$H HD$r^H5aHID$PH8۔HEHH!ADžE11H1HtADžA$HIl$X2I$L0MtBHD$H HD$H@HD$H8HImX4ET HHE111LH7ADžjHL/7ADžuTL1w1ɺ1H5gfHL1ɺBIH514H8ADžH9BADžNA8fDHE1LA<IH5>1HT$(dH3%(DH8[]A\A]A^A_LIv1ɺ1H5DL!v1ɺz1H5WD;\LHL_IH51>@HHL`7ADžZLHrADžL@ADžLju1ɺX1H5LAu1ɺv1H5wfLu1ɺJH5Q~@Lt1ɺ1H5'TfLt1ɺV1H5m,f.Lt1ɺ1H5=f.Lit1ɺ1H5 f.L9t1ɺT1H5of.1ɺE1LsH5>kfLs1ɺ1H5}H@PH8YH{pHGPH5VL LD$HtH@ H@XHtr1HT$LЅtbD$1A L>H5E HCHhX;H11ALbH5_H{kLIH5$11yDLHH5UHPHGPL LD$HtH@ H@XHA1ɺ1LH5,1ALH5s1fDHxGfD1A LH5$AWIAVAUIATEUSDHHHFPH|$HH@HL$ DL$HD$(HFhHD$EQHHH@HD$8ZL*$H$LEH|$DIGP,M4I9DHD$0HD$ HH=7HL$ HH91HHHH|$HH)HHD$ I/1M)L"H5@113LT$ MgM1LHt$0HHPH @LH HH9HGH9Ht$H|$I)1HLHt$0H9H$3H$H|$(qHD$ HH$H$H5^H8iHH|$(1HnIHLK IBHu@H@HHP :uHrL€uLHLT$qLT$L @$D$Ht$H|$$fDL H51E1HHD[]A\A]A^A_H\$IUhCHALHt$H;A7fH1HHLHH)*@H|$L:IH5O1E1VHT$H|$A܂Ht7HHHt.H\$HH{t H{ H[HuH\$fDE1LLT$LIAV1L*SIH5S1AW;H LH1ɺATIL@H5ut$0D$4P1H HD$8LT$@\t$cAE\@D$DeTAHDžHHD$ H H(L0HPLXHDž8HDž@DH|$I+1MLH5@11'HJ1HHM fDD$Le1ɺH5;1DL$@QL1ATAMH5XZLBfDHt$ H;軾HH|$(1H\$HΉD$jIHHIDL1ɺ1H5uLT$L11H5OLT$H|$HcI)1M#LPH5@11MDHT$H|$@LH$HH|$qH$HLSH5E1HH|$H)HH\$ H2)LT$ I1ɺ)LH5,LT$ MLH\$ LGc1ɺXH5E1L1ɺ1H5VLT$rLb1ɺe1H5+E1Lb1ɺs2IL11)LT$ H5PLT$ MLHff.AWMAVAAUAATMUHSHHGH@PHHD$LLH"ÅDHÅ3HEH@ IE@AD$TI|$/ÅBLa1ɺ1H5T%@La1ɺ1H5-H[]A\A]A^A_fDLOa1ɺH51DmTDHTGIHEEth@ I|$DÅ'HEH@El$TH kL`1ɺ1H5m;f.H@ HEH|$CHPh\Au%HEH@H 2H%I|$ÅE9l$TtUL|$DLH}IAt$TLHAV1ɺSIL;H510ZYHEEl$TH@H _DL_1ɺ1H5]+L_1ɺ1H57El$T>f.USHH(HGXH-H4s=HLIH511\H([]H,HHCXHCPH8h*ŅfHsX,H)$)D$D$ jjt$t$rH ŅtUHCPHH8*uHjLIPHD7HCXH(LDIH51qw@HLIH519H([]AVAUATIULSHdH%(H$1IH<IHLHL]1ɺ>LH!ʁ tH€DHHHD@HL)DpLLHAr~HxHH$LHH)HKT5H)DJT0HHLH辏ÅH$dH3<%( HĐ[]A\A]A^fDAEtAUtCT5fBT0IH1HLdLE\1ɺH511yU@L\1ɺ1H5mO+f.L[1ɺ1H5=f.AUCT5BT06fDAUIATIUHSHdH%(H$1HHHHAH=HD$@HD$8HHuAE11HHLRL$|$Hu_HD$PH|$8HI$HPIT$HPH@IT$ID$&H$dH3%(HĘ[]A\A]@HHZLPDL$X1H5¼XZH|$81fLLJH5莼1fHL<OIH5q1QHL4TIH591TOff.@UfHSH8dH%(HD$(1H)$)D$t.H$EHL$(dH3 %(u5H8[]fLGY1ɺrH51}趲fDATUHSHHwHLgPdH%(H$1HHH5H0Hts1HL >t HH5>LP HI|$HHteHEHH$dH3%(HĐ[]A\fDH0L1ɺIH51|f.LX1ɺH5jQ{@LMH1ɺLH5>%O[ff.G[tUHSHHHx0u H1vH1[]fDH蠴HtHPHRXtH2rHH9XuH[]ff.HHH9t:fHPHt HJHtHhHt A[tH9tHH9u1@fSfHH0dH%(HD$(1H)$)D$1҅tHT$HD$Ht HH)H H9H\$(dH3%(uH0[ff.AWAVAUATUSHH(dH%(HD$1DLcPHI$H$H<D$HH@@LhMHLpM{HLHT$ӱHT$AHsXLHHǂhRADžLđADžHxOLHHHL1ɺXIH51hH<$H"ADžQL1ɺ`1H5N0H<$HT$HADžDD$ELNlADžyH{L<1ɺvIH51ǶH<$H"ADžL81H5IL@1}脶H<$Lh INXL1ɺH5fIL[1=HQŅuHLIH5L1,JAUIATIU1SHHGHK @CIu=H{8HtHS@Ht1MLntJuFH[]A\A]fDs41MLH=v9uH{8Ht HS@Hu1L?1ɺH5M/H[]A\A]s0J1MH=;L+fDs,1MLH=;uCHs(1MLH=w;yuCHfHs 1MLH=uHuCHHs1MLH=uuCHUHs1MLH=QuuCHHH7IH=u11CH@ŨHs1MLH=tuCHf.HHH9t7fHPHtHJHtHRXHt AZtH9tHH9u1fAWAVAUATUHSHXH|$(dH%(HD$H1HoXH|$(HGPL8HD$,H5LIMcHD$HAD$LHl$ 1Hl$0HD@HHD$nHL$4IHLL$AF`jE11ɺLPDE1D)UPHt$8lH HH9\$I$H|,LM3HH@H_HH5^I H HHHHBHH¸@H v!H@vH9L$ H%HHt$H1H H1IIHIA9MNHLi11H5HKH9\$ A*LD1ɺH5<E1H\$HdH3%(DHX[]A\A]A^A_H|$(fLmIH51详E1f.H|$(&L]IL$LIH51ND$7DMNHL$H5GD$LC1ɺH5E1"fAWAVAUATUSHHXHOPH|$(dH%(H$H1HHL$0HT$ jH߉D$8~)HHH@HP+DsLEAFE1D$LIH5萠1HfAWAVAUATUSHH $HLoPH|$ HH$@HL$@Ht$@dH%(H$1IEH|$(H$1HHHD$L?tZL=1ɺ1H5 ٟD$0H$dH3 %(D$0uH[]A\A]A^A_@HD$ HD$0H|$ \D$0H|$ S#HHHD$H@HP ALD$|fD$H1HD$H$HD$PH$ )$)$DŽ$D$8D$<D$4D$xHD$pLHD$H$@H9\$fH)$)$DŽ$H@s HL$H[HHHhHK"H H@HPuH/"H@@O u}L|$MtsHMHH$@1HXH9I}HH$IGHLH5趝L$L@H$LHHx L$M9H$Ll$XML$H\$`IƋ\$fD_HGPHxHNHpH9a\Y@HWP'Hr 1H>DHGP@ATUSHo@HHHM1ҋpTHHDHHHCPH8H9[]A\]fDHGPHpHxXfDHWPBulH:tmH9zug1@HG@H@@trGpfDHGP@8u.tqHp HxAT1USHPHHmL HH豭 HiXHI^XHMdL螚HHtf聭 ILHHH 1ixH[]A\H5{鬙@LH511eLK1H5ܗef.HNPHH>AV1AUATUHSHPHHlL IH蚬 HRWLIGWHI^XZ7H<$DE1SHAL1ɺ1H5?]LKHL% Uff.AUATIUSH(Hn dH%(HD$1HHHEH8HEX #@cHEX C-}`tLDkHEX@tOHBCHEX%HHmCTh-fCHEXH%H$H-CCHEXH$H%o-CC-HEXCpHEXHH!HƒkC HL$dH3 %(HOH([]A\A]pHEX CwfDCtHEXH$RHHHHH!zHH-AT$HT CXHEXHHEXH%H)HsMfDiA$A|$H El$EE\$ECsED$(Et A|$HHEXH%s A|$HH0s A|$H{rt At$$tCRA|$ྃoCwf.XXfC_f%HໃrCH4WH0LHBfDH1iLIH51_NHfUHSHH\H5$tHH5cH HEHH[]ƁfDHFhH5cHtHp飁HHecHHD邁fAUATI UHSHH= HUXH%H"rH!sHb RHUX EHLI9.HCH$HxHGXsH$rlH2rMH-Lt=Hyu-HCHhH HH H(DHI9HUXfDHHSHH9tHzHGXkH8ulHLL9uWHL9tHHCHxtHfLfkIH5R~1LHCHhHH[]A\A]f.HCHGhHtfHGPH@XHHǰH9tCHPBt$PL@HH9t*HHAt HLt9t1HH9uָV9WrfDHHNH9ff.HLL9tAfALt)H1HRH׃:u HRR9ALwH L9uȸfHWXH0r%uH%r@utLfDHgHHxHWXH0ruH%r@uuHHHfDAWAVAAUATIUSH(HFLH.HD$HHD$L9DAGL1ۅufA9_LIH @HHʃ:uHEH9t%HRHr1H9pHADH9uuH|$(HL$}HL$HIIHDHxI}IT$PLq H5QLP1At$HIZLYH訾A9_L+fDM?L;|$H([]A\A]A^A_1L̀H5ڀHH(1[]A\A]A^A_ÐATUHSHQIċE`C|Cf1LRH5$w>1 6AW$fAVAUATA1USHHXHoPdH%(H$H1H|$ )D$Hf7HEH(HCXu}HxZAŃu{HAAƅEE,H#tHgL1ɺ1HYt^t#L1ɺH5u1=1H$HdH34%(HX[]A\A]A^A_fDE1HtAC^+ffHC[LRLd$HLD$WHINH=RMH uHH5uHDEHDEHDH1ATLD$H=B%ZYHE1[D]A\A]DL1ɺ1H5qG9x$e H5j2D$9H|$Mt:H<$Lt$޶HLxLL$AQT$8R PDL$L$uNH|$ H˭HtLt$茶LL$HH<$LL$vS PLxLL$H<$Lt$KH|$ LL$HHgHt L $)L $S L[wAQI`(@HHHW E1Hv1Hz j1jjL$H(ff.@UHE1E1S1ɻHHz 1jUjH tH[]fHd1L1ɺ H5-i0H[]ff.H8t fDHHxHǰ蔧HPBu HË@Lff.AWIAVAUEATAUDSHHVH~D9w_I4AvH*HHxIFAF9v0)HHLHHHHHHH9uAIIIPIaHIIWPH0jIH5¼MbIcHHD$HSH$Hx@9FI>$LT$ARH5hL whLT$VAUATRPHPUL;v18 H5Vg/H@L$IL:`DbHD{HHx@EI>H$L gtH tDQQAUATAWPRU H`DL gRRAUATAWPHPULu18 H5f|.H@IEfH[]A\A]A^A_DL$u& H5if6.1L1ɺV H5Mf.H1[]A\A]A^A_@aLts1, H5f-D1LjtM H5e-19HD{HHx@RDI>HhL fHCL fRRAUATAWPHPUARH5xfL YfLT$VAUATRPHPUff.SHHQH@@t HHBH8t0H[HQHtH[fDHQHHL$HL$tHq9^v9^vHQHyAE1ɋJ ÅuL01ɺu 1H5df,nAWAVAUATUSHDaEuQGtJHHL$IIH<$DxA@DEt0HT$HHHBH8tH$AD9`w@1m@HHH,$H]H9u5fHI~ E11j1jjfH uHH9tIELCH0MuI9uEuH[]A\A]A^A_fDAM Ht$E1EH<$LÅuL1ɺ 1H5fc.+ff.AUIATAUHSHYHHHvVHtHD[]A\A]I}(R_Ht%HUHHHPjHD[]A\A]@LcE1WH5b*됐AUAATIHUSHHUH@@@u+HCXH$r0 uEu\tI|$uf1H[]A\A]ÐHHxXuHHuHCXDH7ŅuzCYHXD1LBqIH5a1)AT$ t CYaHDL2q1ɺIH5a1e)2HCLp1ɺIH5na14)I|$uAL$JAD$ wDAWAAVAUMATULSH(H|$MDU DU$E)A9DGMt E9UDELLMEIqDIy11҉ƉD$DD$D9T$FD$A|$hD$JEtXD$`E11ۃD$D$pD$H@HH ЋtF;]LsE;\$`v΀|$uNjD$pDL$pH(D[]A\A]A^A_f|$hDDE|$h+E 1HqMt$HA$$$P1AW#D$DE1PL$@H|$8H0-OAp@T$hHqH|$H$ڃ|$hDT$xu1ɺD$LH5I_'DL$@EUDELLMEJDT$D$[HEA@HHHE1E1$1$jjjH|$8H0AD$L"11H5^X&DL$ZfD1ɺD$LH5X^%&DL$'AAtEu AHDELA@H։L$H臩L$HHHLKH1AWLmH5]%ZE1Yff.@SHL EHH@dH%(H\$81HHL$H$IDH|$H LD$H$WtHKLH(L91ɺ1H5Rof.H1LH4ID$XD$ H0>H5LHL1ɺ1H5+RfDHLHfID$XD$ @HDILH6tHpLH L11ɺ 1H5QgL1ɺf1H5~QFHCLHLɶ1ɺ1H57Q f.H7LHHULHHRLH:jID$XD$ H97LH@L1ɺ1H5POYf.L1ɺ1H5WPZf.MuHOLH$D$ HULHH|OLHID$XMuD$ fDH+OLHHKLHA$SHKLHc9Lt1ɺH5IhLI1ɺ,1H5IL(1ɺz1H5I^fHYTLHt:HXNLHt$Hq(LHf.L1ɺ11H5I[f.Ly1ɺ1H5Hf.LI1ɺ|1H5H;f.HHDd$DT$)EHu-DL1ɺ1H5OH!fL1ɺ1H5'Hf.HILH^Lo1ɺH5GHuHZHL01ɺH5GhHgLHDID$X@L1ɺH5LG@H-LHtHDLHxL1ɺ1H5FLc1ɺ1H5F$HLHtHCLHL 1ɺ1H5{FCMHGLH$Lͫ1ɺ1H5;FL1ɺ>1H5F YH <LHVD$ L_1ɺH5E sL;1ɺ1H5Eq L1ɺ1H5EK HMLHtHNJLHHL1ɺ1H5-E H,LHnL1ɺ1H5D ILY1ɺp1H5D KL31ɺH5Dk uHpLLHLL1ɺ"1H5cD+ Lϩ1ɺH5:D L1ɺ1H5D H1ELHZLk1ɺ%1H5C 5LE1ɺ1H5C{ HDLHIG',HDLHL1ɺ51H5)C @HDLHf2Lw1ɺsH5B kH/DLH(IG@ kHDLHQL1ɺC1H5hB0 fHCLH L1ɺ,1H5#B HqCLHdLu1ɺ=1H5A ?LO1ɺ(H5A HBLHhL1ɺ/1H5AG HBLH(LѦ1ɺ21H5?A L1ɺ9H5AwHrBLH\Lm1ɺ@1H5@7ff.AVAUATUSH|~1H߾A1ҾHD,AƻD, txEA9EtU ݉   ݉ ݉!ALP11MH5@D ؅u[]A\A]A^}1@1A1ɺSLPH5?y[]A\A]A^D5ALP113H5t?< AVAUATUHSHH9t#H;pufDH9pHH9uHIs!Dk H{Ic!AV1ɺfAUI1H5>L0PXID$P ZHx;Ht;@HHHX+|[]A\A]A^D@[]A\A]A^ùLOiH5g>41AUHATUHSHHH9H;stHH9H9kuCvCH[]A\A]f[ De H}IK AULzO1ATI1H5=YH^{H[]A\A]f] H}IATL>OSI1H5j=2XZ1H[]A\A]AUATUSHHHLHL9t+HL{tDeHEAu^H[]A\A]L|H߉FHLfOUI1H5<XZ1H[]A\A]HxDh HHHLNATI1AUH5i<U0H 1OD1L:NH54<1DHGPHHH}SH=@HHtCPPP$H@HHHHt Hu[@L1ɺH5;Q1[øATIUSHdH%(H$1HHHID$PHHH9tvfDH{= HID$PHHH9uԋ4$t=HLuH$dH34%(uH[]A\1HLI9tY11 u&xLv%HL9t!HPHPHRu҃uHL9u߅t*f.f.AWAVAUATUSH(HFPDd$pL$LhDD$CdLL$D$HHHL`A6IHD$LHHD$5IHHCD$I^InAF$D$E~ AF(HD$EfLIF0D$`AF8D$xAFP$$IA$AFT$A$AH$IdvI~x[vIOvH|$htHt$hL<HCĀtHmX1tHMXH(L[]A\A]A^A_DHt$L4IHLL]1L֝1ɺ/H5?81E1DHUy$f 1E1LJH57=@LY1ɺ%1H57f.1ɺEE1LH57^fLLu0L1ɺ)fSIщH@IHHHЋWPLNHHCHt[1L1ɺ$H561[AWAVAUIATIHUSHLD$'E|$ I|$IUL81AVI2SH561AW[H A9\$L|LD$H[M EXHI!MEXr@I$LhhLLÅtzH[]A\A]A^A_@I$Lhuz@붐I|$VAٺ61PAD$LLHH55P1XZfL91ɺI1H55oef.L711ۺ>H5r5:0DU4vSHHHGH@PHx1HtEHCLuHkLH[]DH@HHHH@H{GL3HXIH5411ff.ATUSHGPHL A$@u G[HLgŅthHLMhC\u[]A\H]ŅuHL>IH541뷐HhH53IL61HLgtH&L5I11H53m[]A\fDLGIDAVAULATIUSHALIquHHt L;`HME1jHLjjjjUjjjHPHBHKXHLWpHÅ][]A\A]A^DLqHE1E1jHLjjjjUjjjJHPIH*HKX HLoHCPHIHHxH[}HÅDLz1ɺ 1H51#Hp~IH,L;`"hPh$hML$(1۹LmE H51O[]A\A]A^@hPh$D1Lז1ɺ H5G1[]A\A]A^@ML$(LD11۹ H51HHtH(fDAWAVAUATUSHH(HRH$pHt$`DD$HD$(H$DL$HD$8dH%(H$1HH$H|$('IHHOHIHIXHtHх%HSHH$xaA$HL$`D$ t$LHt |$ I $HL$#D|$Et DD$AvADD$D,$CD$@A9Dl$HD$@tDt$E<"D$D$HD$0D|$0H=<z&IMw`IH6%LH+IH&HD$T$HM~EnID$@AF $`AF4$xAFtHsH{սAF$H|$1Ҿ:AF@D$ D$HE$hAHCD$D9t$L]D1jH5.PL$t$ H.oL$t$ $hHAo$`DD$LDH|$1ҋL$AF0AN,AVDCuAF$\$ AD \$ EL'D1ɺH5-B;P1SA[[DfAL$P$xDD$H@@>"D$AF(>$D$AF0\$ D dEV0Et=H|$Av4EN01ɺPD$TLCH5--P1AXAYD$ t$H|$0؅EA^t)D$0In`HI\p@HHTjH9uHD$8H|$1Ҿ6IFXտIFPHt#HHx E1E1j111jjH H|$1Ҿ7舸AF<$AF1H|$`t HD$`EN$D9r AN( AN$vA)1DHD$hAF($AF$HD$`Ht HxHD$hI~HT$(LFHD$0HHM~XMMM'M9AMnPInL|$Lt$Hp%$I\$M|$L9UDH{wHoH{IwLHH%MtOH5H%, HsLH5 H5 Hq%Q HI9H5NHI%QLt$ LV-H5*wH&L1ɺQ 1H5*NH|$0i$t+AV AVAV(9sA~t En@E-"$H|$h$t5Ht$hHVFLHBtt HCL$lj$HaH$Hp $AF\$td"D$MD|$u I}P|$u LyAw IH5x)1>EeEueAEAM1+$A}$AmD$1҉AE 1uAM,tAM0ډH|$0HHˢH9$H\$hDŽ$AMAUD$(D$HH$$AE $tHD$h9XL D$ |$ I}Pt $$t$H$MAH$IŐ+D$(D$IGXHD$8H$D$DŽ$t1H$HHQH fDHHHH9uH|$0HHhH9tK@HELuHXI9t'C 9Ct CH5HCHXI9uHE HhH9D$0uAU@DŽ$ЃA}@0D$L?1 H5,'AG1+$Aw$ADA_ A_D$AwHAo0AL?))AD$D$H|$0LT$@D\$HL$ uT$AOL )L_?H5&DL5MDHL$(QP1R 4HT$ ALZ?RAG H55&PAGP1HD\$PHU AEL(LEH5%1AVLT$XE1ARDH$HH$AD$HH$H D$D$HD$ l$DT$HDt$pEHL$0HHhH9~H$Dd$LHD$@@HEHHD$PcA} AO(|$HD$8HHM_PLUH9tHsI92LMMILIDHsH9Mt4LT$XHI|$ 1jE11IjjH LT$X HH9\$8uLMM׋L$Ht@T$Lt8H$H$HLfHHtHH]H9HH9uHEHXH9D$PH$D$XH$KD$HL$$t=H$H9HHHfHH9X|H9uA|$EG$A9D$@u AG(D$XAuZA<$u@fD$ $;9D$ HE HhH9D$0AUDd$L($Ń9D$ sAUD dl$ $BT5A 9H|$ AT$D9 t~9tzEH$H$1LD7HHI9t6H9uHHHL LIDJDIHI9uʄt $A teDH$HA0H;|:H1 H9~s9uAw@˅t D9MAW(9A)A96A}y $AO AOΉt$| D$1Aw$D$t6H$QHHLT$HFfD09GHH9uT$D$AODƅt AWHu4IHD$ HD\$IG`E1\$@Lt$ HD$8D$HEqAoHI$C,)AL$HAW0H8HH\$ KH{SA;T$ DT$XT$pL$Pl$LlDL$LHE+O T$xE+OL:H5d RL$`QP1sH LZH}HHIH$Q@EODEtAGHD$Ao$$AG8뉜$DŽ$L11ɺM1H5$fD$H$HD$H$H$$H$H8B E1Dd$ E1A1D5D$A9AH$IJ<(A97J(IOPHE1PHHy jjH0jLL$8衧H uH$IHt$J(HHH: 9tH$HBo*$9GfDDd$ 9vHH$HE$EH$DHH|H?AO0;OH1fDHxH9HxD9ukH|$~SH$D1D)H5m ALH|$xH$H =#$$AE1H5~L}r ?$DHAE1L1p@D$Ao0LvEDML-1 H5AEAG$L H L{1H5}AUK@uL 5]tI}HOGLAttaIUBLAU$fH$1Htx$x Aw$D$(1HD$8HH9B B$9sBEODEtVEGHEuMAw0)+t$(9Ft$t$HBHD$8HH9T$8t.B$B 9sEODEu+t$(9Ft$t$DHD$8Vf.LMMAufAT$D$ׅAG< u t IT$LD$@1HLEuJAT$ЃiIwPH\ LIT$LD$@HL7A|$f@AuCD$1D\$XKAw$AEAAG0A9DBA9rxCE1ɋ$Ht$@HLEDrt&D$XHCHXH9D$PfD1ɺJ MLrwH51D)H߉KbDKDxfDD$1AA@?A$ATAG AG9*Eg0!fDHL$@HLجHL$@1HL趬AD$S@ID$H|$@E1E1H IHL$H$P$P HpH$HH$I?HDŽ$$Pjjj芯H0t:AT$׃sAG<s Lu1ɿH5\)AT$f;Vft$$\$LB09sHH$HL$xH$HHHtHHtHH}H9:HH9uHUHZH9T$PLMMH[ H5ILL)1XAu4AGHHLHH9=HH0Hzt3Hr0H< H H~tH9uHH9HzuD$@@D$1AAyfDAU fD$@$@D$$D$H@MH$xoA P@11HIٹMPLY&1H51A[Ls[1ɺ| LI(M[H5 fDAEyDŽ$a211ɺ MLsH5 ^Ls11 H5u =DŽ$bD$HD$0AFsH5bHH\EL$ L3$PHAD$$ H5 P1A^HA_HM$$L9d$Lt$3Lt$ L5DL r1ɺN H5t A,@La H5N 1E1(@H? 1QL#H5 XZL 1H5 LUq1ɺfL"1ɺ7 1H5 of.L 1"H5t D\$ t$MNDDd$IyHH@u0E11sE^8AvL uA+qZfDLE=fHOPH1DIHtI~xtLH)H9H!I&1MLH5@11OH1EO|IAGhLkPA? H4PJcH>fDL`1ɺdH5$@ID$IG uf.AwTs>HAAGTIEID$H@ 4 1=D@qM1LH5GfAXIo`,8 H9 Ht$IG`AoXH9v1HD1AOhAՅt$9wzEg|Etq)Ht$)9s\ẢL$A)$1L H5@H1ATL$A1AOhD)AOhAXAYnDL$Dd $E)1LWH5n@H1ATL$A1#AOhD)AOhAZA[DHCXH& H'. H} |L1H5A4AG4HDH@@tAWHtHKXAOh@D)A9HLRIH5e1+fDAG8EwPEuKI(uDHD$ LPAH51ͿY^?fDAXAG4xAPu I(AG4AOhfD\$"D\$1LH5@E11ɃGD\$ID$E_T@ AD$L1At$8AIw`AGXv I` AxEohtE)H{XEEtIML$AA"u=E\$LEt1IqIyDƅDDE+Y1A1A͋D$D9cD$HDAGh({0C\ AOh=DA9IT$B E_XA*v I`IE1E1I9u8f.E@E@@tD9uYAHI9oHPHRutt tՋH8I PL+W9A@AttI`uL1H5kfDHxHLIH5[1!X@HCXH'yH$H@HHAoh@H;kH@@H蠌JL H5膼L1H5\EL|$DH\$8E)AOhfDEH\$8D)IAͅt 1ACL5AOhHжHk ,Ht$ =B9D1AD9ΉH|$0H6EH|$0HD$HD$II1MLH5E@H11HT$R 6XZ@HjLAUIH5*1A[[fDL1H5ĺLmX1ɺZ8A8*f.H8wE1HAxAxAhD⋰:2AGhAA|IWxG$HAH9IL-^HNALEL5?ZAUA1ATLZCH5AVP1迹EO|H %f1AAxx1AAGhAGx5AA9AI}AGhHI1AL"H5a@H11ATA]EghA^1AAx0AAGh@1ҋAx0AAGhuDII9xLW1AhAx‰s0AAGh7I$LhIŰKDHLtIH5[1!@ALJE_xEu ALJHH96AL-ALJL- t L-L5@H;HPHLB W+JH{PAGhH|$HE1A7HsPHt$rfH8uHߋhT}uHlj3tAOh9HT$H:HI41M&LH5@H11UŶAohAYAZ9l$++l$AL1H5tEEGXI`HA>H|$0ALHD$d1LL$LH56@11Mo`L1 15H5ĵLmS1ɺN8L-L5ALJfHx9HHWHx YAHCXOIw`H|$0LIH5U1fDHL\IH51@H谯IHHhH|$0HH茕HT$HAGhHH9t$9rAwh‹t$DH|$0H艕D$DA;$tLA$ID$HHXALJv1L] DH5M@11AOhAD+l$]L 1H5̳@LQ1H5蜳HAɺD$ L,PfDHLIH5s19p@fHL4IH5+1(@L,H5ƲH߉t$DD$ 6t$H@@DD$ E9GX3Hv6H^=L IH51WfE1E1111AAx*AAGh@HAɺD$ L PHD1Lt$HI>AGhIpH1I7L H5@H11AU蘱_AGhAAXEGX!L%O1ɺH5]Ll$01ҾLpL4HcIw`Ij1MLH5>@11ɃAGXLN1ɺ01H5ְJHAɺD$ L PDt$AWAVLAUIATUHSH(LH$HL$dH%(HD$1M9t2Ld$fIGLHHxH1ku D$9LM?M9uMIM9t9Ld$DIFLHH@HxH1u D$9LM6M9uэKH$Ht$1HH耳HIHL$dH3 %(uH([]A\A]A^A_ѦATUSHHtHtH[]A\fIHHHt L`I$HtEH[]A\L 1H5<fAUIATIUHSH_HHt'LLH9HCHt@HH[]A\A]fL 1H5茮f.HH1LL11H5RATUHSHHtsUIH}HhtQH_hHtH{tHpL#[]A\fDLH#[]A\f.1HX`DHEL 1H5LHH1蒭[]A\ff.SDHOEHApHQpHHH9t%H;ptrHHH9tH9stdHHHH9uHFHQHL Ln H5=H@HRɹPHLE1^1_[DH#HCDEtDH@H@h[fHHHHH9;[fDHxo0H@`[AWAVAUATUSHdH%(HD$1Ht/uSLI1ɺ 1H5ZE1Ht$dH34%(DAH[]A\A]A^A_fLw1HIvHI~P*.HQInhHtHH=ADžI^pMfpL- L9u4s@:IFPHu~HzHGhHL9tAHSHt DEEtIFPHuHHzu)/HH@`L9uI~PH4$AH(o!f.HxHADžwLH1ɺ$1H5ȪHEH1MH5LHHHB!pH1萪YHS^=DIvHI~P1ɺ,HIFPLt^HAvH1ɺL& H5m1A-AYAZLG1ɺ1H5;HAvH1LE1H5ϩA[[fS1HHtIH=H1H%HH H[L1H5tH5tA1E1LH5I@LC1ɺAH5C@LC1ɺ-H5AWAVAUATAUSHH(HGPT$HHD$s)HHCPHxHD$H H|$L54zt$HD$E1E1DIdMO$HE1HDщAWAVjjjH|$8 |H0IEAW$AW HՉЅt AEL)‹9Mtz|$usDAo A)EW$ExHN(IHLMO$EW$APLtIx1HwHxkDAh Ip1HCP(HxIHttHxH|$LXLA1ɺH5,HD$HD$H([]A\A]A^A_@D$tAG AO$Ln1H5螣HD$HLKH1UL_H5fZYHD$fLJH5g4?ff.@SH#bt[DHCPHKX@HLKHL H5 1͢XZ[fSHau[DHCPHcXHLKHL H51mXZ[f1efDAWHAVHAUATUSH8HOXH|$Hljt$T$HL$(HD$D$$D$ L|$AG[tSItILI_H_HLH@ H5LHHS1諡A]LA^/bHD$\$1L8DL9t$(IHHEA9^$mIFhHt@IVHL H5bLJHpH1!I~hA[A\aIHt # zIHt DT$EIFH@ IHxIF@^tfLvIIH@@HL*u+D$L >1ɺ1c tIFH@H%s4IHx< IHt# ZMMLIFH@ tHIH@A9F$t1AF$I~.LO1ɺRIH51zLE~$MFAvLIx t 1A@YE(fE1AE;fLDDLl#uL<1ɺH5 ٞL<1ɺ\1H5踞E1H8D[]A\A]A^A_A+@1ADAAŅ^fDAV$D)AV$uAVPD)AVPMvD)HD$|$ t D$D$$D$H|$+t$/gH|$!Htt$ ,P$L$HL$HAPH9XHL$HxHGH@H@HHtHt$ЅbHtH HD$(tFHD$L@PIXHt1IIH90HHPHJXfApDIFHxL(HIFH@,AzEE)~$EdfHEL1VH5蔜AXAYIFH@H%OH|$V HPHRHуL$ tDx(1EL$ D$$2HPHJXHH9uI8qHD$H@PHXD$L91ɺ;fHL$PPP$f.D$LU91ɺaH51苛D\$1ɺ"D$L9H5^D\$1ɺ%D$L8H5d1D\$r1ɺAD$L8H57D\$EAV$D)AV$HH'HCPHqX(HǀXD$L]81ɺD1ɺ<D$L:8H5~D\$H<HD$L71ɺ}DD$L71ɺw1ɺ9D$L7H51D\$?1ɺ,D$L7H5љD\$D$Ll71ɺ3D$LU71ɺtD$HD$H@PHXLIH51YD\$ff.@1ff.@AUH59ATUSHHHGPDH8eSHIEuDALD1HHH!CX耝ŅtRH[]A\A]HXŅuL;61ɺ1H5q1L61ɺH5GH[]A\A]f.L51ɺ1H5G1 SUSHHC\tF9t^HpHVu6HL +Nt H{PE1H_Ő9tHHߺ[]3HuH\uHt\@H tHԱLIH5W1H1[]@MfHHCXuSff.SH#uHÅt[fH[31LG41ɺHH5[ff.AWAVAAUATIHUSHHL$dH%(H$1#HkPIH,HRADžDEHCXH!H"H& H'H.H/H$HHD$@HLLIHCXH4H%H-H4Mt EU(EHD$HtH1HH`)HLL9zHl$LIH HH9RHCHxG^tuHCHx LIAL211H5LH$dH3 %(D H[]A\A]A^A_H訮LIH5+1HpL41IH51蹓h@H8L48IH51聓0@HLIH51E1FHȭL%IH5K1@H萭L+IH51ْ@HXLIIH51衒P@HHHHCXHDHT$LIHl$HNHCXH4GH-sLH)QH߉D$]AŅH1ɿHL 6LH5H@pH1ȑAXHAYH|$QHkHFHD$HtWHlADžuCH|$AIMLH5c11'HHLDHSHHK HLL>RD$uyD$D tpEHH H@L@HH\$ 1HHcE,0ILAH511mADHwQHCXHXHt @[HCXHHLHhHD$HRGL$Ht$DLfHCX1ɺNE1L_-H5裏RH"iHCXUH)LPH@Hi01ɺE1L,H5b/f.HsH1H5>1L L^_H+HCHL {HPLH51諎ZYXH,1ɿL(IH51xH`QHLMHݨLIH5VLHIEHIH@AELAEPAE$HɈHtHPHR H$HCXH|$iH|$A$IMLH511eHD$oIT$ H=Ht H=HrM, 1LH5*HulL9IpLu*1ɺ1H5諌ZHHD$HT$HhHHD$HT$Ht$DL"H|$צLbIL)1ɺRH5I1E1 H߆HHx1ɺE1L)H5ËrHL H@H@HH+qLI&H L6?IH51S1ɺE1L(H5_,H该L1ɺIH551HxL(1ɺH|$XLvIUH4L]I1L6(1ɺH5nH}H-HtH}HhHZL'1ɺLCHH M\襤LI1ɺE1L'H5܉1LH5赉d;L$IH51膉5AWAVAUIATAUSHHXdH%(HD$H1uHEXHEC[HDH%JADžRHLHoLh1ɺbIH51軈HFMDLHp!ADžfDuHdSH褲tPLmDHL)ADž.AHL$HdH3 %(DHX[]A\A]A^A_fHADžuHCXH%@1H-slH`XHCXH(s]EuXHKPHHH9tAHHPHrXtHPHrXHH9uf.1DHLADHUHADž:HLH蟡LIH5"1E1HDHCPE11HL$ AHH8qDL$ EcDD$8EUHt$H@ADž D$P$EHDHӠHIȠLH=&H1IVHIn HMPH;HL ) j%ZYIVHH;HHM=L1ɺ1H5J|L1ɺ1H5\$|dL1ɺH53|@HŅL1ɺ1H5{LH5ֳ{ff.f1uDAVAUATAUHHH@SHHЋtkuVLjDr΋WPÅ*UPDHÅrE1DLDH.|Å@[]A\A]A^ËUPHEÅuLh1ɺ1H5ֲz@HBWPLhDpÅt\UPDHÅDLDH#{ÅiL1ɺ1H5`(zHL1ɺ1H57yf.L1ɺ1H5yf.Li1ɺ1H5ױyf.L91ɺ 1H5oyf.L 1ɺ1H5w?y_f.AW+LuAVAUATUSH(HG@4_LHLgDAH5DGTLO0ID$PO$DT$W DPDD$Dw8H8LL$L$ T$3HLjDT$,HARAUDD$8APE1jAWSjAVLL$`L$\T$X{vHPIHEL1ۅu P;]LsHHLu1ɺBE1LH5FxH(L[]A\A]A^A_ÐHDžHLH"La1H51E1wLx1<H5˯w{ff.AWAAVIAUIATUDSHHJIIu I$8t9L"1H5MwE1HD[]A\A]A^A_IEPH5H8]1I9D$tLIHtA$9Al$LLADyy!t-I$MH IHBHL DHHL rXH9uD9rifH;HA9tLH1MLzwu։D$ L1ɺH5K1vDL$ IMXAL1ɺ1H5uE1@HA PL1H5̭uXE1Zxf.D$ L%1ɺEfAWHG`AVAUATUSH(Ho`Ht$T$L$HD$H9IAH|$DHH{u;pPHC@ut$HHHDkLAt$HDwrAD$E1ut@AE9|$veDCt=HHHHHPWuuӉD$L(1ɺH51^tDT$H(D[]A\A]A^A_DsPHmH;l$HD$HHXH@PHxHGH@H@HHtHt$ЅAH|$p H|$D$]HID$$L<H5ӫP1sZYDT$8H|$HH5AVIL1Zs^E1_D$L1ɺL1ɺ1H5PsE1D$L1ɺfAWAVAAUATUHSHHHLfPH|$HdH%(HD$81HFHHD$(HD$ AH@ HCXuH1ADžHT$HLlADžumHCX@@MEHHkHH@HhHEAHL$8dH3 %(DHH[]A\A]A^A_@D$A$L ULóHlH5LD1E1qZY@LKH1L H5qYLKH1L!H5Pq)L@KtL&L1ɺ1H5C qfDHH#HHH@H@ H@XHtHKP1HT$H9Ѕt D$cH8L| IH51pZ@HD$HHx7HD$(HHT$ H5=,H腥ADžtfHD$(HHCH,EHd"HADžL 1ɺ+1H5oL 1ɺ"1H5ofLE1H5çodfDH-HKfff.ATIUHSH1HH~PHdH%(H$1't HH}PH5VHhHtkH1HLÅt-H$dH3 %(uaHĐ[]A\Li 1ɺD1H5צnDL1ۺ=H5tneff.fbfR2fAWH1AVAUATUSH8Ht$1mL 1ɺHiIHD$MH@PHHH|$(H9H|$(HWH9T$LHH|$ L9MMDAwLE1MEMu]AD9CDL<@IIL8uHL$H9HuIyEqPEA hGE|$EtDd$ML|$MEE@II9t!S 9w C$ 9wHI9uI|$EjHLAUI1H5lXZLT 1ɺ(1H5¤lH81[]A\A]A^A_f9D9A)DMDd$MAqLAD9MMM?L;|$ |HD$MH@PHt$(HH>H|$(H9H8[]A\A]A^A_D$I|$ADtwC$XEMLd$D|$IJ| I~HUSILAWH51AUVkH DL1ɺ1H5_'kwfAW1AVAUATIUSHH@H|$(HL$1LD$ LvHLJHH5 <jM$I$HD$8AXAYI9D$ AWLKE1fDAE9oL2DH@IL4L8uH9Xu΋pHHHHM@ A}L H|$HM0HH!H9IuPBT1AOP991HDLqID$PH5H85$HEHL$ ELH|$ HD$ Hx覚HL`H|$HAD$ E9oLfDM?L9|$(D$ tL"vA2HLKHL_POH5/1h^E1_H8D[]A\A]A^A_VML$HL)H5PRasHQAG P1hH0E1IHLKHLHBD0PmHLKHLVt$H5QP1ChH E1GD$ L11fH5JhDT$ LhkH5gE1LTsH5gE1L]1ɺ}H5ȟgDT$ ff.AWAVAUIATIUHSHHVPHHH9t>IHsH9t MLHLADžHUPHHH9uHADžI$I9uHL9txH{HgX迂ADžuLq1ɺ1H5ߞfHD[]A\A]A^A_DL91ɺ1H5ofDAL 1ɺ1H5w?fff.fAVIAUIATIUHSHHH9u CHH9t8HxXt1LzH5e[1]A\A]A^fHXIHHLHH9t!Hp0HhH!L Hp0HH9uH I#FX[H EXHI!FXAIH]AdžA\IdžA]A^AVL1ɺAUATUHSHH(dH%(HD$ 1wHLNHH5dAYHAZ_IHLhL9t[HsHLMH1E1H5LqdY^HL$dH3 %(DZH []A\A]A^LLyA|$LI$8cH9hH9tAą11HHAąIEPH5H8'HAH1HZhAąHmHH5oHWHAH}HEL$LL0P1H5bE1'cXZH}LHMHLASfHsHLMHL1H5b_AXJfH8}HI$LPD Ef } LPPDfDHE1|LIH5X1bfL1ɺ1H5'a{L1ɺ1H5aUH-Lc(HHUHt[HI9u(1ɺE1L5H5yaL1ɺ1H5SaIEHHLH,$H5)HD$oAąL1ɺ'1H5;a9XfAWIAVMAUATIUSHHHNHHT$Ll$0HLdH%(H$1Zd2HSXLCP1LBHHH.H5>LWTHnHCPH1ɺTMLH5A1 `YL^H5&k1HHdLHHHD$HL$L9uM6L;t$tnIVI|$Ht$c2uL1aH5k_H$dH3%(HH[]A\A]A^A_@H{P/9-H{PnRHL;]LL9l$t%LfDIuL0MmL;l$uHLMHsH1L˜~H5ޖ1^_11AXHHbH5~LHHE11jHHjjjjQjjjLL$hR\HPIHE111HH`_pHLHKPHHHAH@@Yu2L%Ml$(LLUIM9uEDHHHHCh뷐L91ɺH511m]L11GH5r:]DHCHHT$ H5HHD$ HEHHD$(JL1ɺ1H5\t@LĚ1OH5\GLQ1ɺ1H5\fL)1ɺ1H5_\f.L1ɺDHCPHMLAY1H5;1\XZHCPfLLH511[\HCPkLLHCPHMLtiRf.AWAVAUATUSHH8T$L$dH%(HD$(1FY IHH8>Mt$`Il$`D|$L9uXM6AI9tEDHIHAv@P9sAu HAEPM6AI9uHCPH Θ HH8H[HtHH@HD$HpHHCPHx3L 1ɺIHGHqL1LAD1HD$LCPHPXHD$ H*DD$Ht$ HߺuHCPH5 zH8JHD$H Ml$`I96t$H|$`HD$H HD$HA E1H$P jjjjjQjjjHt$pH|$hzWHPIHJAD$E1ufAE9t$qDDLHLHHPYuщD$L1ɺH5&1XDT$,DL1dH5XE1HL$(dH3 %(D3H8[]A\A]A^A_Hs^LIH51aXE1@HrHLAWIpH5]1#XZE1Y`fH߉D$rHH5'ID$ LqyP1W^_DT$HD$ LH\HD$MmPPHD$ T$I9HCPHKXHxHGH@H@HHt HЅAD$L1ɺ2HqLIL1ɺH5)1VE1.L1ɺH5VE1Li1ɺH5ԎVE1H!qHLID$ P9MD$L1ɺTAWAVIAUIATMUSLHhH|$PHHt$HL$@kHD$H H{dL1H5"P1LAvHMMHUIuHI~PAXAYH HHD$0HD$LHHD$(L|$XL9Ll$8Ld$HIALE1MEuAE;wLDL$@IIL8uH@IPHpHz@H9~@uIP HH9tDt$ MMHI;^ IJD(D`AGPkATCŃ9rA9wIwFtAOLA9r~9vH|$D)Aw ͮuLB1ɺ.H5zTL#1ɺV1H5YT1Hh[]A\A]A^A_D)H|$T$AG $S $T$VL1ɺ'H5(SvMDt$ AE;wLf.MM?L9|$(>L|$XLLl$8Ld$HLt$Ht$0IFPHH$?IMD$HD$HL;|$XZH$LAOL1Iu3A9_L#H $HH@IHЃ8uH@HPHz@HQH;z@uPHA H(H9tMDuAA9A9AOPT$0L$(imHD$ H$H@Hx@riHLL$0I1QT$@RHt$8VH5AVUtRH0t$uxMtsI$I9t,H|$HT$H;xuDH9PHL9uHD$PHx;HH|$HHxLD$fDH@IHЋHBH5qHhDpIEPH8" H1HD$8IGHHpHH@PHAGPHt$0ATHL$(T$ Ht$0LI1VHL$0H5}QT$01RAV;QAOPHE1AAWLjjjjQjjjL$L$L OHPHH1LHn6H|$HHyIUPAGPE1AM LHILQ>L71ɺH5oPAG AW$HLܾH5~R{PHD$ pHMMH1/PH 1Hh[]A\A]A^A_f.HmH9MDuAAD9w9 fDL1ɺ1H5OKf.D$LI1ɺH5O @L!1ɺ1H5WOfL1ɺ1H5g/Of.LM?L;|$XDHn1ɺLPLt$1H5 LAvHMMHNIuHI~PXZHuL_1ɺR7HHD$0HD$HHD$X1LlH5]N1fDAWAVAUATUSHH $HHD$$D$dH%(H$81H$HD$$D$D D H詃ADžHCPH8B;ADžGHCPLKHH H0L1H@Ht$0HHt$>QNHCPHt$1H83IH'H/ADž ϴ'E>EHCP1ҾJH8BH߅gL1ɺIH51LfHXgLtIH5ۄ1LH$8dH3 %(DHH[]A\A]A^A_DHfL\IH5{1ALHfLIH5C1 Lc@fLܻ1ɺIH51KHLXfHHCPLMI H8OhjLƻ1UIH5ƒ1K_AX耭1fD1LL$LAHsX+ADLKHLKH5:1E1JWEHL$Hl$HHBH9ILFFeIHCPLH8DgUL1ATIH51MI vJY^o@HD$ HD$(M1Hl$ DHT$ HD$(HHT$ L9HL9v LH)HD$(A~T1H8tv@8c=1L L2PHPH5ځ1IXZnLHLd$(Hl$ dH謰L HLLDHATUSH5v1E19IH LL$LzDHcL1ɺIH51HHCPj1ɋ$ALH8RD$HT$(OA[]ADžqsLH#cH軯L ɆHކLDHL1SH5NHAYAZD HCPLH8dHIbHIL HLLDHATUS"?fUHAWAVAAUATISHHdH%(HE1I$AI9uzHL9t`HH{ADžuL1#H5QGHUdH3%(DuHe[A\A]A^A_]@HCH@PHHEtEDHHHHHHH)HH9tHH$H9u%~H\$M4$HH]M9rIE1M6AM9tWI~A_H|HMDuIvHEL nXH8膯ADžPIFM6AHH!HXM9uM,$M9uMmM9fI}j)EjEuu)EH ADžuL1ɺF1H5}EHEM,$H8M9tQE1 @MmM9t?D9vHuDEv<uIupHEMmH8M9u2L1ɺVH5g}4EL) 1H5<}ADfHt#HtH'Lq1ɺ21H5|E1DNA<DI}E1 _LeIQH5|1UDHEH8A}H)HLtHEAH8yE@HEI~^L^;IH5|1C;AWIAVAAUATUSHhH|$HT$ DD$DL$0dH%(H$X1kH5cHIGPH8HD$HgHCSLt$HHHH [D$$E1Hl$PLKdILhMt-LHtHPB tHD$$LhSLNlID9wKID$4E1HD$8L|$(D|$0NdLiD$ 1ELt$H$QDD$ DH|$AYAZ1ɺD$LH5[z(BDT$H$XdH3 %(DLHh[]A\A]A^A_jLDDAt$XD$LD$(H|$r_AXLd$(Lt$HCH@t 'EID9kLDT$$L|$(EDKLE1Zf.HHRHHI$HA$P$PP9kLLH@IL`LHuL3RH5x1@E1DLhA  D$0DŽ$Et$8A$HHBKTmsLE1LdjDAt$XLD$(LH|$qZY1LID$PHT$8I$Hx2D$4FDD$$S$L$ ʉS$0SPt$ LA;|$$AaIoX*MoPuLe.LL1ɺK1H5dw,?sL1t"HH@HHxF9kLwIwX*DT$$L1ɺH5w>E1L|$(D$HLML$HAwHH5v>A[[DT$a1t$CPD$$uHCH@H D$4D$$D$4HCL$4H@L$$H `LG JD$L1ɺ5H5'v1=DT$Ld$@D$LrCLH4@HCHH@PHxnDT$HHKLE1tcAHxD$,5E+CZ!HD$\kqHP H5 nILU15HQPH=zH1SHAŅ-CZu|$\JLL`1ɺIH5]j1#2HKXL1ɺp1H5#jLd$@1L1ɺ[1H5i1-HCLLdIH5i11L01ɺH5iLd$@c1L1ɺ1H5uiLd$@81mKLIH5Ai11K$LDIk(ff.@AWIAVAUATUSHH(HoPD^LHI#JI˒AVHL$1M<AQ@1LTAT1H5gAUO/H HH9D$)H(D[]A\A]A^A_HLAKHHIH;AT16UIL@H5g11Ƀ.XZf.AD)HD\$AƉL$蒲L$AWXHDIw QD\$AO`ASt$(AVEGTH AƅDkfDHA+wh>AƅuL1ɺ*1H5Nf.HHCXHT$1HHL1ɺ11H5e-f.AWAVAUATUSHH $HHHoPHT$HIdH%(H$81HEHD$ HHD$BE|$8IEIT$(HE1HxHD$H'H?HXHuAHRHCPHHD$(ҰIHCX  @ DE% HCXH" H!L (g,L1H5dp,L1ɺ1H5dO,H$8dH3 %(DHH[]A\A]A^A_HHCXH EL$hH%Eu8I|$pu0tIAD$0IT$pE1ID$(AD$xDXAo$Aod$H$Aol$ Aot$0Ao|$@)$I$)$Ao\$PAod$`)$IAol$p)$Ao$)$Ao$)$)$)$)$)$H$ iIID$(H$AD$0$HXELDIH5b1*LJ1ɺH5b1E1}*)HAHCXEuH@ H Ao $H%AoT$HI$IL$xAD$hAo\$ )$Aod$0Aol$@)$Aot$PAo|$`AoD$pH$ Ao$HSP)$Ao$)$)$L:)$)$)$)$)$@HLHHAvLHAA1AcWEHCXH%Ht$LHߩ@<ZD$L Ai@B9Ei'BD(AdD9DME|$h$EXIH$I?HQIFH@@C\t A|$4H0HCXHHHHBLIH5`1'T@HLH8HALHAA1WEL1ɺQf.L1H5t_<'@o@ID$`HE\$PEtwHCXH%r)H&r"H'r@uHxH(rH7sDHXAI1ML-H5^@11&AD$PET$XEwHD$(H@H@@XH0IHdCZA|$4HT$H|$L\\ADžA|$45M LTIHHT$H$H\ADžA|$4\ $N AD$PM'AT$huM D$E HD$@\ E1A|$4u C[  Ht$H|$ M1H11ADž1 M L DH(E H|$ P( HT$H$L)ADžnD$E%HT$H|$LADžpA$tDH|$JADžGH7XHD$@\ A|$4@HA>H蚇1IcH5u\Lx@110$At$Pt A|$4EHD$H@PH8 Ht$H|$ ڍH|$h>sLcIH5[1E1#ZfA~L[H>LHbHH5[SIL71V#^_HY HCX@dHqHXLH=LxIH5[1"mDL S8@AD$h$A[IE1AD$hffDH=LIH5Z1a"@L1ҾL1ҾAAA1ELh1ɺH5@Z1A2"L1H5 Z!E|$hfDsA HsWH#D$LPfLٕ1H5X| (HL$(HQHRBXA 蔃1LH5kX@11- AL$PAD$XID$` fDEL$TEHD$(H@H@@X{1LŚH5W@11AD$TAfLI1ɺ>H5W@HD$PXH@H@ H@XHtHKP1HT$PH9Ѕt D$PL91H5LWL1ɺ.H5WI@MHH9D$t,1L{H5V@11ED$PEu A|$4LkPL|$PfE11ALHI})D$P)D$`D$p2A|$PD$P=AD$LA|$4AT$hfAL$@ED$DE1H޿ADžfDEL1ɺfL1ɺ61H5'Qf.HCPH$0LKHH,HHt$(HL1H@dHCPHt$(1H8YWHD$0HnHD$ Ht$0H'HHD$ Ht$0H'HAT$hDH|$ )։T$1LLtIoX+AF(tIoX,IHP IGXH-H$5HD$Ht @\8LH{AV4H<$LMDL$EAVDLL҃+ IH@H* T H|$t AG] M A2H<$LJn2IGPH8rAM AuIgXH|$pH|$EFx1LOAHHAV4Ht$H<$nH|$(L1"IH1DL4H5;KXZ@AHEN|IyvLL<H5;fDL$H|$ HD$ !L&@[\H|$ AVxAH?; H<$H5'L`1ɺ!IHSHL$IF/H<$L1@ƃAv4L L~IdL1{_ fLX L1ɺ`!DLL61ɺ"IH521IFD$HLHD$@HD$LIHD$TAFDD$\t$Xt$Xt$Xt$X+H A>H9L 9L:b"H5t1LD14IGPH8H<$LcL"LIL1ɺ!1H50fH*]EEH;H5L?1ɺ%!IH2HL$AFfD1ɺ!E1LH5q0>fH|$Ht$L'HH AMHMEEvxL${L$MMDDH3gHITUx1L"H5/Hu{HHL`b{HLS{HWgLH8LX` H|$Ld$`IwHH Lj H<$L1LI萇L1ɺ"H5.@MHILI nHQAG]VH<$Ln`BLLOp"I|LN(H1Lwx AQH5U."_AXf.H L'xIEEQH*H,H<$LIGX^IwX,fL1yALP@tyAPDDL51ɺ!1H5-Of.LQ LuHLɒ1ɺ=!1H57-f.'H<$L^ LRLS{!IH5,11ɺ E1L*H5,n5HMNX LwwE1H5i,6XZLLȑ1ɺ @L1ɺ!H5,H~ LuMN`K LJvIQLL+yR0!LLHHaL1ɺ"1H5+K1ɺ E1LH5W+$L L}"IH5*+1LfI|$HHLQjIHAuSPAW1H5sD$TPT$TH dGI\$HkA$`I$IVXH1H-A$HA$LWI$PtcLpeI|$HHLiIHtSPH5r1AWMD$TPT$TH dyI$XtcLeI|$HHLiIHsSPH5r1AWD$TPT$TH d ID$@_+LdI|$H3HLhIHrSPAW1H5rmD$TPT$TH dLHtH@@L dI|$HHiL hIHqSPH5q1AWD$TPT$TH depHMNH1AWH5UqLzgT$DBD$DY^dDLXcI|$HHmLkgIH>qSPH5p1AW5D$TPT$TH d\LbI|$HHLgIH qSuPAW1H5{pD$TPT$TH dLbI|$H+HLfIHgSPH5p1AWeD$TPT$TH dHt AF\HIFXuHID$HPX$ HA|$LuyI$8ulHxZHtHHLeIHgSPAWKI\$HCHLNaI|$HHLaeIHrSPAW1H5n+D$TPT$TH dWI$H YHtH`@L9qL`I|$HbHLdIHfSPAW L`I|$H%HLdIHnUPH5n1AW_D$TPT$TH dA$HID$@_L_I|$HHL dIHdSPAWdI$thL_I|$HTHLcIHfSPAW1H5LTI|$HZHLXIHSPH5Fb1AWD$TPT$TH d~1M9$M9$M9$M9$h1M9$AtM9t$XM9$IL$YE9t_HAt$ L]RAT$$RVqHMNHP1H5^aT$dBD$dH0dIL$HHH9uuHH9fI9u1M9$HmH;l$MIL9udA IH9GhtDMNH,Lf]AQwH1H5`T$DBD$D_AXdM$$I9ID$DHxEuKHt IH9p`tID$MNHLM]4H@AQpHyCLRRI|$HD$(HT$(H5_IHXLTR0P1.D$DPT$D^_dNI$HDAT$ AD$$HL1^LIHAvHH5_пP1RT$TBD$TH dFHQHAD$$HLT[AL$ MNHAQRPQR[L1QI|$HHLDUIHUUPH5^1AWD$TPT$TH d#5LPI|$HlHLTIHUSPH5X^1AWD$TPT$TH dI\$HkLXPI|$HHLkTIHUSPAWLPI|$HHL.TIHI^UPH5]1AWD$TPT$TH dE$EMI$tcLOI|$H:HLSIHaSPH5&]1AWtD$TPT$TH dI|$htcL,OI|$HHL?SIHZaSPH5\1AW D$TPT$TH d5I|$`7LNI|$H`HLRIH`SPAW1H5H\D$TPT$TH dLUNI|$HHLhRIHc`SPH5[1AW2D$TPT$TH dPYLMI|$HHLRIH_SPAWOLMI|$HSHLQIHTSPH5?[1AWD$TPT$TH dJLHMI|$HHL[QIH9TSPH5Z1AW%D$TPT$TH dQIFXLLI|$HHLPIH'[SPH5kZ1AWD$TPT$TH dH;LeLI|$HHLxPIHQSPAW"L(LI|$HHL;PIH[SPAWLKI|$HHLOIH]SPH5zY1AWD$TPT$TH dMDEtEAWLOHjH5*Y1LUsT$DBD$DY^dE1MNH1L^H5X2T$4BD$4dCWH5URISP1iD$TPT$TH d$N@ID$H@ ti @uHHu  uI$AD$8PtcLFI|$A\$8HTHLtIIHVUSH5@TP1菻D$TPT$TH dzHt$4LAT$Hv$ID$@_ H@P ID$AT$LH@@G<HHmE\$L1EungLEI|$HkSIHVLWHP1H5YS諺D$DPT$D[ZdA;l$LH@HI$H؃8tnLAEI|$HD$HT$LGIH$VRH5RP1D$DPT$D_AXdI$HHxGYtHID$HpXID$H@1&I$HH؃8HIT$HZXHxxLLDI|$HSIHtULFPHxXLDI|$HD$HT$H5QIHTLFRP1D$DPT$DY^dfA$XA$\A$A $ A $$A $(A $,A $0A $4A $8A $<A $@A $DA $HA $L1L CI|$HHLGIHVS8PAW1H5PD$TPT$TH dI\$Lt$Dl$ HkD$|LBI|$HD$ "HT$ LEIHgHH5PREP1]D$DPT$DAZA[dGI$HDPL BIT$HLGLJHPAD$LPj@LAI|$HzSIH;RPLbD1H5eO輶D$DPT$DZYdAD$8LlAI|$A\$LH L3DIPHQUSPH5N1JD$TH ; 0A|$<L@I|$A\$Ls@I|$A\$LHL2CIPHQUH5MSP1QD$TPT$TH d3L @I|$A\$HHLBIPH7USP1H5MD$TPT$TH dL?I|$A\$HHCLlBIPH7USP@Lh?I|$H H*L{CIHHRSPH5L1AWED$TPT$TH dlL?I|$HH(LCIHQSPH5L1AWݳD$TPT$TH dnI$uYLw>I|$HSuIHNNH5LPL@1\D$DPT$D^_dEAD$8#PtgL >I|$A\$8HHyL@IHMUSH5KP1D$TPT$TH dA$;AD$<E\$@EQED$DEID$@_ uA|$HvbLW=I|$A\$HHL@IHF5QUH5JSP15D$TPT$TH dID$H8HPXLIHFLWUH5ISP1D$TPT$TH dML;I|$A\$IHKARH5PIUSP1蝰D$TPT$TH dLX;I|$A$H{L>IPHHKUH5HSP13D$TPT$TH d`L:I|$HSwIHRKPLy=1H5|HӯD$DPT$DZYdAD$8~rL:I|$H&SL&=IrHMJH5HP1hD$DPT$DAXAYdOID$H@I$L:I|$HSZIHJPL<1H5GD$DPT$DAYAZdI$AD$8ID$@_ uA|$HvcLi9I|$A\$HHL(<IHZ1ARH5FUSP1FD$TPT$TH d-HID$HPXt[L8I|$HSL;IHH5FP1֭D$DPT$DAXAYdHt$4L1L8I|$A\$8H"LC;IHHASH5FUSP1aD$TPT$TH dCL8I|$HSIHGH5EPL:1D$DPT$D^_dL7I|$HaSIHGPLI:1H5LE裬D$DPT$D[]dLX7I|$HHLk;IHJS%PAWIL7I|$HHL.;IH?SAPAW1H5DD$TPT$TH dL6I|$HVSIHELB9PH5AD1薫I\$D$D_AXHk}LX6I|$HH Lk:IH=SPH5C1AW5D$TPT$TH d<\L5I|$HHL:IHIS?PAWL5I|$HVH=L9IHHSPH5BC1AW萪D$TPT$TH dLK5I|$HHL^9IHGSPH5B1AW(D$TPT$TH d|OL4I|$HHL8IHFSPH5rB1AWD$TPT$TH dH@HxX|Ll4I|$HL8#IHFWSPAWL44I|$HHLG8IH;SPAW1H5AD$TPT$TH d8L3I|$HoHL7IHESPAWL3I|$H5HL7IHk;SPAWLU3I|$HH Lh7IH;SPH5@1AW2D$TPT$TH d^ID$hHPXDMNH1L?cH5@D$4ML@>SH5e@跧T$4BD$4dL+HtHHtxLt\MNHM1L=H5@VT$4BD$4deInXIL=WZH8uL9puIfPMNH1VL;H5?֦T$DBD$DAZA[dL1I|$H4UQIHDSPL51H5?AWsD$TPT$TH dID$H@0L%1I|$HHWL85IHDSPH5>1AWD$TPT$TH d.ID$H@ff.AWAVIAUAATUSHc)HH'h D9HxGLH0D@(HH$HpPPCTPPCPPCLPC8PRHPIHHIFPHHx'yDHSsL)B7A)D$PD)E1CPAl$$K$K AL$ DHM$H,@HHIAutKPJE1DHRL辥I$HMNHL<D(PHHD(pHAUAWC PH5<1&H0AD;{LCHL I~PeÅFH[]A\A]A^A_E1LJ<H5g<蹣LbA1ɺ1H5F<1薣@HBsPELLL$PHx)p<LL$IAHI$HD(PHHD(T$H@Hx@HMNHL;T$RPAUAWC PfInHH-{L:UIH5|;1AUʢXZ 1LY@1ɺ1H5=;菢f.HAvHEH5 ;L91QY^Yf.L):1H5:^L:H5:0L?1ɺH5s:ʡ Ln?1ɺH5O:覡Ht G[tDuuATLgpUHSH_pL9thHCt.Hxu!HL9u[]A\Ð[]A\f.1ff.AWAVAUIATIUHSHHHt/HxXHXpHt HՅHtLHՅMMM9#IHt LՅIHt LՅIHt LՅ\IHt LՅqIhHt LՅIHt LՅAGL1ۅuuDA9_LvgH@IHЃ8uHxLՅuԉD$ LI=1ɺsH53>1DL$ HD[]A\A]A^A_M?M9L[tmIIŘL9u XHL9tMH{LՅuD$ L<1ɺzrL<1ɺa1H5=E1aAVD$ Lu<1ɺj'D$ L^<1ɺhD$ LG<1ɺlD$ L0<1ɺfD$ L<1ɺnD$ L<1ɺpfDAULATIUSHHdH%(HD$1D$L9t]@UL1ۅuED9]Lv8H@HHЃ8uH@Hx$tIL$X9]LwHmL9uHT$H5LÅt5D$uHL$dH3 %(u9H[]A\A]IL$XL;1ɺ1H5;7pATIUSH HWXdH%(HD$1tHL$dH3 %(uYH []A\HHH4$HHWXH5HLd$tLHHSXHHHSX֓fDAW AVAUAATIUHHw SHLwPH} I9t9HAML$HH5:1E1LJ>_ ^_M$I$HD$L9AGL1ۅuA9_LH@IHЃ8uH@H} L`L$ I9tMLHmAUI1L=H5":E1mZYA9_LwDM?L;|$RHD[]A\A]A^A_AWE1AVAAUATIU1SHOIDI9vl@A薍HHPuyC<4vbHE1ATH59E1AL]=辚LY^IŐDI9wHD[]A\A]A^A_fDH Hs:u[@tUHE1ATL.=E1AH58AʉAŅtN!I<$HAU~1SIL/1H5."|XZHD[]A\A]@ӝI<$HŞHH5!SIL.1{)Y^DH[]A\A]fA$6M$L1.E1pH5!ӂTfDHH9tHL$ !L$ L-E1hH51!f.u]H1HHtNH)H?HH{1Iٺ\H5 L@11A$I<$HH[]A\A]E1L4E1uH5s ƁHD[]A\A]X1ALb,H5; 艁 @ATIUHSHH9t6fDHCH@hHt HH9HGHL9uHt H[]A\Ð1[H]A\fDSHH1HGHHLJ(HH)8HC HCHCHC HC(HC0HC8CHHC@HHCXHCPHǃHǃHǃHǃ H H H H H H H[ @SHH?H蹾Ht6HHH9t#HJH;A@uDHJH9A@t HH9u1H[HH9tH;pu @H9pt HH9u1fDHHH9tH;pu H9ptHH9u1fATUHSHH9t%IHH9tH{LtH[]A\1H[]A\fDATI/UHLSqHHHPLEHH9u-DHH9t HCLHxHuuH[]A\@1H[]A\ff.HHVH3GhH3WpH upHFHVH3GxH3H uXHHH9tEH LLVHH9t0HBLH(L@ M1M1M uLFLNL3@0L3H8M u1DHHtH@HDAVIAUI/ATL(HULDLS}pI$HPHLEI9u?HL9t0HkLHEHxHtuMtI[H]A\A]A^@1Mt[H]IA\A]A^ff.ATIUHSHHtLH Ht[]A\f.11LHH1HtHtf.HHH9t#HBH;p@uDHBH9p@t HH9u1fHHǰH9tfP 9wP$9w HH9u1HHǰH9HDÐSHHdH%(HD$1D$HtbHtPLuHT$dH3%(uiH[H8uH@Ht$H@Hx@,D$9sf.1L '$H5<{1srHHǰH9HDÐATIUSHH_ HG H9t0@HCH@@HtHLЉŅt%I|$HHG H9uԽ[]A\1LW1ɺH5Az[]A\AWHAVAUATIUSHH(谭8AE$A9E$EA$uHCIT$H@H9BI$I$HL$HD$H9 HLHD$HD$H@HhHHD$I9I M?M9IGHHpHpuI/E1H5Lg&A$ZyY^H(D[]A\A]A^A_fDA$A9LZ%A$H51x_AXfHD$HHD$H;D$I$M$I9uafDHmL9NH}HtH}HHL%IS:DHLj$P H51A$1xH 1E1LL#H5wDHM$L$ 1H5dwXZSLpHAeAD9lE$A$L#SHHH9uPHmH9t?H}L+tH}I$vHL>$ISC3Aff.fSt+HHH9t@HPHHbXH9u1H5cÅt[1L/1ɺH5gv[UHSHHdH%(HD$1pD$tbHt:HLKH>L#D$ H5P1uD$EXZHD$dH3%(H[]HGPHx胫 twHCP1Hxp HT$H5Hd1HzHCP1HxK AL1ɺ1H5RuDHHT$H5I1HDL1ɺH5u7lATLUHSHL9u CHL9t;HCtHPHH}HH HL5HCHL9uH}HdH}HEHH_ HG H9t[L%fH}HHG H9t@HCH@8HtHHЅuM1ɺx H51t[]A\ff.ATLU1SHL9tH{HL9u[]A\fUHSHtjL JHtLL8!11ۺ_H5#qsLZ!1aH5MsH[]@HuH[]@HLiL9!P1H5rXZff.H1HtH=fDAWAVAUATUSHdH%(HD$1Hu2AHT$dH3%(DH[]A\A]A^A_fDHHauHHAH9tIHH9tH{uHCLHx@tH{fL4$IL9vH{E1.AW1AVI1L H5XqXZhff.fAWAVAUATIUSHHL2I9HHL$IHE1DILLM9t@IHBH@pHtJH}HЅuI}Dt@HLU ILM9uHD[]A\A]A^A_AH|$H3 vfDE1AWAVAUIATIULSHHjH^HE0Ls H0L} HLHD$LHHL$LHHLA t H uIYtAHD[]A\A]A^A_DL tH|$ tff.USHHHv`HFH@8HHt'HHЉŅtJHH[]fH{ptSuIHs`HHHFH@8ЉŅu1L 1ɺ7H5NoH[]DH1LJ2IH5 1oH[]fDL1%H5 n,AWAVAUATIUSH~I$8M$8L9A(DI<$1HJHmL9H]HuM$HH1ɺAWI1LH5 nID$HH@H@HHHCpY^HHHYHE16L IH5c 1mHmL9=fL(I<$oI$I<$I$EIٹ1LOH5 >mHD[]A\A]A^A_@M$HxHLAVI1H5 E1lXZoLhI<$I$I<$I$fD1IٺLhH51 A@11sl0fDL 1ɺH5 IlI$EfDM$Aƹ1L5 H5 lL 1ɺH5 kI$(AUATIUSHHƨHHG`LnH{@H@HHFF,HFt)1HL|ŅtVH[]A\A]@H߉Lq GIH5 1kH[]A\A]fHhHNL AUI1H5 jXZH[]A\A]ff.1Ht1?#ff.Hwu DH1jLH5 `j1HfHHt :u.H1Ht >tH=cATUHSHE1uuLD[]A\@EauL1L H5QAit@Hh{u1A LLH5UiD[]A\DHH?A@FNf.HHfDH>HHUHSHHH`tZ1ҾH3Ht8HX Hu(-uH{?t H_tH[HtuH1[]DH[]@1Df.AUIATIH=USH[ HtVPHH膜 HHtfH{ HhAELcC H{0w HH[]A\A]fLi1ɺ1H5Q1gLY1H5&tgHl f.HGhH9t3USHHtHHHtHPHHRRhH]hH[]Ðff.@UHSHHH H}HsHH[]sAWILAVIAUATUHH5TSHӺ:HpLgL$1dH%(HD$`1HGHD$1jfAX(AYLٚ HH{pIdADž|$ ]H $HC`H;At_Hp8ILSH51E1eY^HT$XdH3%(DHh[]A\A]A^A_fDLHADž ILk HCpHAoFhLHCxAoNxAHH$ǃHxHGPKHL0HgLd$@HLJHIATLp1H5dXZfDHILL6@@HIALZx@I=LH51E1Nd]fHIspLC0L1ɺI1H5E1c IL)tH5}cfDHLHAt A;tHLY:AHкH9I]LLDAAH$H@H@PHHH9t$H;_uH9_H?H9uAIL _H5}bfDLi1ɺ{1H5QbD$HIjLsH5P1A`bH k A[1ɺE1L H5%b4PILA:Yf.AW LTAVAUATUHH5pSHHHLdH%(HD$81D$,aHLLA1M9tbHD$0L|$4HD$IED$4D$0Hx@Ht+Ht$L tD$4tED9MmM9u1LHL9EHL$4Lt$,HL$HL$0HL$D$HLIH}LH'H5HAUI1L `HEAYLAZHHx@<HEHT$D$4Ht$D$0Hx@ EtPD$4D9tGtCH@u |$HLiE1P81H5__AXLmL41LHHHmL9LHHH AHL$8dH3 %(DmHH[]A\A]A^A_fH}L1ɺ4IH513_NfDH}D${L,IH51^D\$[f.H}HD$,HBLSI1H5R^XZD\$@L9 1ɺ1H5!o^E1MmAM9A9HE;PH5L1^YE1^|FUfDAWAVAUATUSHH8Lg`Ht$(ID$PH@HHD$ ,k Lk(IHDs0HD$HCHD$HCHD$M$HCXHoAoHAOI@I| 4HD$IHHT$HT$H9/HD$HD$I9H|$ (葑 HgLxI|$PHID$PHLAID$HLMg`IGpID$PE1tPH.tD؉At1Hl$ uHA$11DL$LH53CXZI|$Lt >L 1ɺ1H51JCDATUHS u(H]AH9u fDHH9tHHtAD[]A\fDAUATUSHH8HIąHAA9HyHH1H55MP1LsqBYH^tIHH[]A\A]Ð;+HtwH'fDL 1ɺH5AH1[]A\A]@MLT1H5sAH1[]A\A]@MLdf.HTV+HUHA1VH߉ATL~1UIH510AHXZUHVMLAH5@1ff.AVAUIATIUSr I$L5I9u(Qf.LL s t\HL9t+HkH2HLHr t6L9#uLL9uպH5Lr td[L]A\A]A^s Lz1H5?[1]A\A]A^ùLzH5|?Lz1H5[?HtgSHGPHHx@HHt HHt[@HYHLSI1H5HCS 1MLH5pH12/AZA[HCH|$XHH Lm1X H5.zDM6M9IF@Y tHHH9uIDt.LHHLh11 H5..IFHHH9tHKSLAutHLHH1LCR H5/.]1XIFIL11H5-L 1ɺ 1H5-Lz 1ɺ 1H5b-VHC@^H$HMpHLb ML蜤 Ŝ HD$8HL 訜 HD$HHxII9IGhHD$HD$`H$H$HD$NfMNH AL1H5m1,XZHI9mHC8LpIFPL9uHt$L#Mn H|$H L՜ HtQH4$@L/A11AvH H5LL$L,Y^IvHH|$8衝 HMNHHAL HMAvHLU| H4$@L}EIFPHt$@Hxh^IFPHMNH1t$L H51t$6+H vIvHH|$8L H|$HL L诛 kIvHH|$0艜 HI~hI~p\  MNHHALi LA 1ɺ H5&y*-L 1ɺ H5U*L 1ɺ H51*MNHHALy 9L1H5)E1IHH MPLH5J1)[]1L~1ɺ_ 1H5l)L1 H5C)Lg1 H5)H=H€!H=wH€H 1PM1L^H5W(A\A^L]1 H5*x(5LH=LBIT$PLLAVPRM1P 1LwH5'ZIYL訌8LhBIT$PHLLP-HA11MH57L y'^_bL 1ɺq 1H5Q'L1 H5('ML1H5&2HA11 MLH5m&AXAYL[ 1ɺv 1H5C&NL1 H5h&%L|1 H5?&L@IT$PLLAVPHAWAVAUATUSHHoOxoGhdH%(H$1HGhD$pHD$)D$P) $)L$` HLL9twL5 fDHmL9t_HUHHtLuHH;LH#HEHmL9uHLHI9 fDHPHRHL9u1AIL$`HmL9t2HEL`L2A!I|$`uHu1{ HfDEHLeL9u fIHEHP<tYLzHL臇1Ln HAWMP@H51Ƀ1$H}AZA[wI$LM9uHADžC`uHͯtHNtHH(tH6H7LAŅ;uH7&H7N L+AC`eH{@HX賰ADžHL 1ɺ 1H5"RD1ɺ ALz H5k"L1Ly H5@"H$dH3 %(D Hĸ[]A\A]A^A_L LH515"E1띃'HO69LA9 %HA)g6H߉6HA6AU LAVLkH5gP1U!HH{H DHG蕇IH HCLx H I9 A@HCM?H I9h LuDAtȾLAuH{L=R L(DH(5HD)LǃLuD蛪H;LH譬HLC(IM9L|$@f.D$@IvH9t!H;rH H;pHH9uH~`LHGP@|$@H{(T HIVHHHP袕 I~LBH1ɺ AUI1H5qLHY^I@M6M9,L"H9u*LM轕 I$LI9IHrH;iu1ɺ AL H53fDHIqfLAǺp H5SfDL 1ɺ~ 1H5q'HCE1Ll$PHh H H9uZ@HvL1ɺ 1LQH5`M H{HmHG H9sHOIE uHH;HL!u-HEH@ HDH{HHЅ`AfLL4DK( 1AWL5H5iP1XZH;1Ҿ4ADžLL1 H5"pL LL LHLź 1ɺH5L 1ɺ 1H5E1AE%Lg L9t9fAD$ u"ID$H@(HtLHЅH{M$$HG I9uHA HL$HD$@o[hH$HLHHD$(oaHHD$@L=QHD$HHD$8Ƅ$HT$)$)$Lt$@HD$8HD$ I9@LpHoHh HD$H6H$$HL^21H5=IL1K zLT$LLJHZM6L;t$(MfHLLD$ HT$LHD$8H6H(H9u)HmH;l$8L11ɺ9 MIH51HLLKLuL1L1ɺ< IH5O1LQ1LR1ɺN IH5!1mL 1LA IH519HHT$LPL1 H5?LE1 H55L\ H5SL1L# H5({H{HmL% HG H9u )fDH{HmHG H9E uHEH@8HtHHЅuM1ɺ H51L 1ɺ#1H51L 1ɺ H5kH{Ho HG H9tL%R H{HmHG H9VE uHEH@8HtHHЅuM1ɺ H51OD)H߉UL 1ɺ&1H5ɶL 1ɺ 1H5FHE1LWH5hH{AXLAYH LT 1ɺ)1H5<L. 1ɺ1H5dff.fAWAVAUI1ATUSHI}1ҾILcMIMH+L9uuDHEHL9tdHH{HGHP`L9LH)L9vXjtTHCL1H2H5PH@LHH1HEL9uAHD[]A\A]A^A_ÉD$ HCH.MLaH5H@pH12XZD\$ fAWHAVAUE1ATE1UHSHLHD$I9fAGL1ۅuA9_LH@IHЃ8uH@LpHEPHIv@H^%I~@=,HAI/H1AVI1H5LHA^_A9_LrDM?L;|$BEtEueEH1[]A\A]A^A_fD+HAIt/H1ɺKAVI1LH5lZYH;/L7RIH581H[]A\A]A^A_H.L71ɺWIH51DH[]A\A]A^A_HHHtHH] H1ff.fAWAVAULATUSHhHdH%(HD$X1L9HD$IIHD$fIH?HH9I~@IL—IHID$Hx/H1ɺ UIL1H5ӱ!AAHZIYI;fHL9ID$LsHhILHHIF@A Hb)H1ɿPM1H5.L uI~@^_ALRIH?HH9L%DK@1PCH1IHt(H' L_ MmM9uHLM9OE1D$H$Uf.UMPLR11H5IFHXZM6M9tI~@H贐uƄ$IFHx@HGtp[UMLP11H5'AqM6A[XM9uD l$t HrHڦR HLI9uf.HmL9cH}1#uHELLHHH51 HD$PH|$h(LXH|$1ɺLH1jD%PH|$L1ɃQMLGH54HL$P1ۉ9DML11nH5H|$L觰HH$(dH3%(HH8[]A\A]A^A_H$HT$H|$LHH$H$~L$I9`L|$(H$Hl$MAHD$ M?I9MoI}0tA}<uL:H{HDŽ$MuH}`LD$L1ɺ`IH$eDH8AE8A9H1ɺPH5DL=1Y^H}L5 WEL|$(DL$ImLI9t)@z LIXHHmH9uEDT$tE8H|$8K(LHD$XL$HHT$`EN(LRHt$`VL$XH5nQ1P1H LD$HHDŽ$LfDLl$8H9LX)H8IFH@HtTHL$uFHMH%HDL1ɺH5ˡP1UAXAYD$@H_PML1UH51^_DML11H5^]MN(IE0I97H1ɿPLW1H5iXZfL1ɺ1H5?f.A$A$ID$LH@PhL 11 H5L-l H|$1ɺL, D$D` Lt$H\$LLH訅LLHJH$HMH PL1pH5GAXAYLHT$H|$聬@H|$LL1ɺ1H5DML)tH5ufHI9u_HmL9KH}-uHE L\LHHpE1L1ɺ1H5/f.HCHHt/HIٹPLn1H5_AXHC@Ht.HIٺPH5nLg1Y^HD$hH1fHML1UDL) 1ɺH5a@H|$SHn%fHD$Ht$Hx=IH1J H|$11 LL$LpH|$LHD$HRL H|$1ɺLy D$DML1H5LfH舋HD$@Lt$AHD$HH|$nH&1HL$HH @ HT$  LC 1ɺ1H5+tIELHx@H1ɺHAVILH5ޛ1*AZA[IELHx@HI1IAVOLLH5y DML|$(EAF8HMN01ɿLPH5(1yL$A[A\E1ImLI9DH訽A4oChoKxƄ$H)$)$L9t1DH}H@t谂uHEH@@H`HmL9uH$ HHH9uHH9HJA`uH=* HD$XHh HL9H\$0Ld$XL|$8Ll$(IŐIEHx HD$~ HHQH(H9EE1F L- L1LH- IAHmH9L}AGauEtH5jLW- uL\ 1ɺ7 H5AH\$0L|$8H|$X* L) 11 H5_HD$* ]Lؖ 1ɺ'1H5 1@D$L 1ɺH5M L@1H5\HLF 1ɺH5+~H|$1vMLL1ɺ1LH5̖E+H5L* Lh+ D$ E1HD$`HD$HHHD$HH9Ll$xEDML1EuF;]L:H@HHЃ8uH@H@Lx@MAGauEu= LP) L1LH) )EfDH5L) uL 1ɺY H5H\$0L|$8Pf.DT$ E"H|$HL1ɺM IH5H1Dt$ Ls1H5fl}WHD$A Lܓ 1ɺ1H5Ĕ:D$DPt&CaHD$uDl$ExDd$tEXHD$H{t+ H{@t2L~1ɺT1H56H{@[HC@H{Ht2Lu1ɺ[1H5KH{H"HCHHS8HCHsH|$O.HC@H.LfH5 DL 1ɺH5vCH|$:^1 1ɺMLH51L|$(E1ɺMLzH5L|$(IL1ɺ1H5ؒML|$(ML|$(듿L11H5AL$ImLI9Lw 1ɺ"H5\@LN 1ɺ: H53H\$0L|$8|HCHHt/HIٹkPLH51BA[]HC@HNHIٹmPLH51AYAZD$p<ZLuHD$ L1H5bsLO 1ɺH54L+ 1ɺ3 H5H\$0L|$8YL 1ɺH55~Lُ 1ɺB H5H\$0L|$8xL 1ɺ\ H5H\$0L|$8JLHL<e1H5QA^XS$1LLUH5 \$L 1ɺH58LH|$1JHkH?1LL`H5LLj1H5YsLK 1ɺU H50H\$0L|$8yH 1LH5L?Y^1L1ɺH5ɎHD$LL11H5LLPoLX1ɺN1H5@L2 1ɺH5jD71LLPH5781L^H5Ǎ=L 1ɺ 1H5a1LH5uLg 1ɺd H5LH\$0L|$8H dH%(HD$1D$ jLL$NZYHT$dH3%(uHfAVAUIHATUSHH9t(HhIH;U@u?HhH9U@t.HH9u1L 1ɺH51jHLL9tQDH{迬t7H{H{t'I|$ " Ht/HSHLHP$c HL9u[]A\A]A^fDL 1ɺH59[1]A\A]A^f.@1fUHAVAUIATSHHHdH%(HE1$d AƸEu'H]dH3%(He[A\A]A^]DHHHBHHHHH)HH9tHH$H9u%t H)HLLd$1ILIEI9tLHHHHHJL9uHpDLDHt.@AVAUATUSHH $H IH=|LNHdH%(H$1Hl$HIHrRiMH@HLt$H$HFPL1D H߅ H1ɺUIL&H5B1KYL^1H *IH(HhAŅtqLd1HLLA謝L$H$dH3%(DH []A\A]A^f.HCPHDLH5LsH1|XZLDIH5B1E1CZfDIL~DE1 H5 )DILD/ff.@UHAWAVAAUATIHSHHH8D4D0dH%(HE1` B1H HL膈HMDHHHBHHHHH)HH9tHH$H9u%JHD$1HHH HH@HKHHHHǾ1 E&EH DDhAFIDuHDH(5H81HDlID4L;(LCP1H ?I$HAE)EEuHCPH5NH8菢jI $Dj4ID0H8ZYjI<$uLIH51fDHKXDEHDH HpÅ(H}dH3<%(QHe[A\A]A^A_]H0kH8LH5L 1ɺH511kfDH)HLf.HHL$zIH51I<$LcIH5T1XML1H5&,LɃ 1ɺHAWAVAUATUSHHIHHg\ ADžMIHD$L9AELI8E1H@LuHXL9u/uDIFH@@HtHK@Ht H@8H9A8tM6L9tHIvHmtAE;eLsDH@IHЃ8tMmL;l$^AHD[]A\A]A^A_fDUHHE1S1HdH%(HD$1HGPHL$H8t*1ہ|$HT$dH3%(u>H[]@HLJ=IH5[1_SHHP裥HCPuH8H`MÅt"[ÐH8H޺[1L 1ɺH5[AWAVIAUIATUHSHHHHGPH߉T$ 1L VML9uRfI}P臽t I}Pʘu~Lo1H5LRE1sDM?L9tIWI|$HuD$ L;1H5DT$ "@D$ u0LLAHD[]A\A]A^A_LhttL,t(LLLuD$ L> 1ɺWDLD$ LIH5I1MDT$ iD$ L 1ɺH51DT$ 7D$ L 1ɺff.AWAVIHAUIATAULSHH8DL$H9tIHIL$IH51E1H8D[]A\A]A^A_DH耠tgCED$L$uL}LL9u@M?L9|HCPIWLHxسu܉D$6L'H5ط1DL$CfL1ɺ)1H5A@ML/>HLI/thHfHHD$(D$HD$D$D$؈D$t$(t$(t$(t$(ґH HL HLILh*LeHL9tIt$H蓱M$$L9uA H{P蟹tH{PL3} 1ɺ=1H5ciE1LBH53>LeLL9tfDIt$LM$$L9uD$tH"H*H{PtH{P4L1zH5E1!L/H5E1D$L+| 11?H5[aDL$L3VH5*5LJH5HLGD$jLnH{P|E1AD$tLH>Lں]IH51DL.OH5U`Mff.AVIAUIATAHoUHSHdH%(H$1HH xgMHD@13HH1HLt`H$dH3%(HHĐ[]A\A]A^fDIL11۹H5lwDLz 1ɺ1H5IOzf.Ly 1ɺ1H5JUDUHAWEAVIAUIATESHH(M}dH%(HE1:H_H8HKHHH5HMLuHMHtoH)HHPHHH)HHH9tHH$H9ut H)HL4H|$HHHL3uH@DH{PLIHm}v:HDH9wxjMLE1AWALLZYM1ALLLH]dH3%(LHe[A\A]A^A_]L)HAL1ɺQIH561:=DH@H5kHxH,HKHLEHILѸE1[H5հ.fDL&E1UH5fDLٰ1HH5v|fHWX1tƀtHHHf.GYt>S ]HH8t 1[DHxtH[H@fD1DSH5HHdH%(HD$1D$0HtsH@ H@XHHHT$1ЉÅt(\$HL$dH3 %(H[DLv 1ɺ]1H5IODLu 1ɺW1H5!'DLu 1ɺZ1H5i5DAUATUSHGYuH[]A\A]f.H[IH@@ uAmLCY uŅt11ۉL$@IIL8tA;]LrޅtH[]A\A]ÐHxu fDIJ| GUHSHHHHtbH@@tHH[]fDH}H{1HqHLUI1H5XZ멐H}7LIH5|1sff.҉USH։HH9w\H9vUҹ)HEuEH`91I麬L]H5@11H[]DL,1ɺIH51H[]fDAWEAVAAUIATAUSH(HGPT$ 1LD$H/L#s 1ɺxH!H5HHHI}PHD$AHDH AIIEPAL\$tzAUE1ɹjI}PL1AWt$(PjDD$<$H0HH\AA1LH1yÅDL1r 1ɺ1H5agH([]A\A]A^A_fDLq 1ɺ{H5+11-L11ۺH5H*1LH^Å@L_LkIH51fDL(L4IH5m1qj@L1LʲIH5317fH(D_LA9LDNH@IoHP) $HT$E9vGKIESIfoHH II HzHyA9uA)ACIKIIfo$HT$HPH(fDA1LjH5[a1H(f.USHHHt-HLJHH/HcXHHt HH[]Lo 1ɺ1H5٨ff.fAWIAVAUATUHSHXHt$T$dH%(H$H1UAGYE|$`LHIGPLHHD$(H1ɺePDl$1LʱH5#E+YL^UHIHhLeHcH\$HL$@L|$ I@IxOEtJIN| LVuHLtˉLyAIy@H\$L|$ ELt$0E1E1L F AIGPHxn HeHhHLAE D9d$CLHH߃CLHH@H‹SPHhHeXuTHu1LVIH51MXHIA,D9d$wfDIGPHt$HxV IEHHIGPHHtH=LE E11{LL,LgHÅHtHLMtLLAOfLil 1ɺ/H5LRoH5y1}E1H$HdH3 %(DHX[]A\A]A^A_fDLLt[IH51E1@1ɺD$Lk H5DT$iLn H5E1 u?H[eDHH9u1DHywKHH@H@HX@Hu1[ff.HGY uUHHH9t@FLt1HH@HLfD:u HB@Y uHH9uH6H9u1ff.fHHtHHf1HfAVAUATLUSHI9tiIIHkLuXtQHyJH8t]HHH9t*H9uHIHIL9i@tHH9uHL9u1[H]A\A]A^f.HJHHxIHH@H@L9h@tHL9LDAUIATUHSHH IHHHC; H]H9u)_HSHLHJHH); HH9t8I} HuLpf E1IH539HL[]A\A]L՜1@H5DAWAVLAUATUSHHL9IL-qHEHHH9u}DHEHHH9tfI<$L{L~I9uHHtHEADžuLb 1ɺb1H5GMHD[]A\A]A^A_HmL9^AH_ff.@UHHSHHHHNX!HHH[]阼AWAVIAUATUSHhH$H|$ t$HL$DD$,DL$4H\$8dH%(HD$X1eGIċ@LD$HtD|$,H|$ HHED|$HDD+D$D$0H1ɺ.SIL\UH51AWH tLn1D$4*A\$LXDl$EHcDl$D$(H,@HWMHt$LAօt#`LF6D$(AtED$HD);D$s4I$L|(LtL;tufD$D$+D$(D$0Hl$@H7 D$0Lt$ A;D$LrOfI$HHJT*HPd7 AT$PL%FiA9\$LL,@I$IJ|(HgXKIFPHHxv HuL^b hH5$/E1L|$ L#AG[H|$ D$KLIH5Ǘ1DT$+@Lq>H51E1HT$XdH3%(D8Hh[]A\A]A^A_Ë$@\$tAL$9L$0tD$D$(>1ɺOD$L] H5 DT$rD$0AD$LODL$0EDD$,E1E1EnI|$}Q-H|$ rHt$4ÅQLl$@I9CLd$IHl$ MmM9IuHu1ɺD$L\ H53>DT$1ɺnD$L\ H5DT$nH\$ E1HL1ɺIH5ϕ1ӾL{HIHH!CX%MIFXĀL1oBLI1LơIH5G1PA}L#Lt$Lt$ L|$Ld$PIHRL<J|9HgXILHJT9IT$3 A9]LIFPHHx IHuLj[ 1ɺ1H5蠽E1D$L=[ 1ɺH5o1sDT$LILd$MtH|$ L`aMtH|$ LD\|$0XHD$8HtT$(H|$ H1ɺPDL$81LH5̼ZAY&D$D$(D$0H|$ 0I$LxIgXL\L$H|$ LITWD\$4EtH|$ H5H|$ CuHHT$ H!BXH|$ @DT$,IEtMu HIHT$ BY ;HH°H9$HH0 HH9uH|$ ?LOI|$HmHt$ E1HڹH~PLHH?|HLY@D$LX 1ɺf.Lt$L|$Ld$L!tlL.D$LX 1ɺhD$LX 1ɺQD$L|X 1ɺ:D$LeX 1ɺ#LD$-LIH߉D$L)ID$LX 1ɺ|腱D$~1L H5DT$|DAWIAVAUIATUSH8H|$Ld$$H $DD$ dH%(HD$(1D$)؉ÉD$LMI^fUDE1LAUDD$LHL$Y^L$$ED9AtAL)IHty+\$$Mt;t7LA9=9XLwL,=DXLEsfAA)MuEtAucHt$(dH34%(DH8[]A\A]A^A_DL$$Ld$11ɺ$LrV H5趸D $;\$tIH|$H7Lt$ VDL$,H5eA)1kXE1ZNL:13H57=E1"pAUIHATIUSHHdH%(HD$1;/ tNL/11H5ʎзHT$dH3%(cH[]A\A]Hpu\D$HcX1]HHnLHAKŅwHL$E11HLŅ|$uHH=H1OH[]A\A]Ð1LeH5 H[]A\A]ff.@AWAVIAUA1ATUDSHHHGPt$ 1L IHH5OLoH*AWA1jH{PE11UAVRHAUH0IH!HKHH{PHLQNIHt@L$ 1AHLL2tNLFHL[]A\A]A^A_@L91H5֊ܳf.LE1H5諳fLIQ 1ɺw1H5ydf.1ɺzE1L Q H5CN3f1E1LH5@AWMAVAAUATIHUSHH8DL$dH%(HD$(1* tRLH51覲E1HL$(dH3 %(DH8[]A\A]A^A_DHE1]6HHD$Ht HdAD9pv81ҾLdvL1ɺ1H5 11HO HD$HH5LRlH)HD$L\$t#IC H@XHt11LL\${t$H{PAE1jE)1LڋD$1PAWPAVĸH0IHtEjMHE1AVHT$AL[Y^ALDT$NDT$q@D$LH51DT$;fDL%tL%66HILEH@H1ATI1LGH5{膰_AAX HELRDL$HL1HXZHcH4HH D$LM 11H5DT$fLM 1ɺH5E1fLYM 1ɺ1H5華E11HL$$E1HL;…1ҁ|$$D$Li3fDMK(D$1LzH5DT$OfLi!f.LyL 1ɺ1H5诮E1|fAWA1AVAAUIATUDSH1HHDD$HH5LIhHATE1jL$hH{PQDt$hRHUD$iH0IHDT$`EuGjDHEUDL$HLZYLH[]A\A]A^A_DSHSPALL9DFHHPDL$hL$prHD$AXAYHjLLEUDL$DHt^_ufH|$dtHD$HxP2*L1-H5L.H1[]A\A]A^A_DH0Ht$HLtJ 1ɺ"H5謬1LGJ 1ɺH5yH1[]A\A]A^A_fDLJ 1ɺH5>IH1[]A\A]A^A_1LҒ H5 19DHD$HxPBaHD$HxPJLyI 1ɺH5豫ff.AWAVADAUATAUSH(l$`HD$hDL$p\$x AIIAuQ1EEH(LI[L]A\A]A^A_H<$DL$HD$L$DD$ EL$L$DD$HD$DL$t#ALڑ1WH5蕪'L܂1AH5flH(1[]A\A]A^A_ALo1cH5$*H|$1DL$HD$ $DD$E $HD$DL$)LT$DD$DIDH(L[]A\A]A^A_IDLy1RH5v| l$pDLLDL$hADHD$`H([]A\A]A^A_L1uH5AVIAUAATIUSHHHPdH%(HD$1HT$+trT$HCPL H5LHHCATLD11舨Y^HL$dH3 %(H[]A\A]A^HhŅt"LDLHqŅtC@HLIH5~1v@LE 1ɺ1H5~קL ff.fAWAVAUATUSH LD$Ll$PHHAMw+IH@@tRH9HrI)؃:EHLpH[]A\A]A^A_L1H5}H1[]A\A]A^A_L<1H5}̦f.HRBZbE1EHT$LAHH[]A\A]A^A_xLY1H5V}\SHENL1SLAH5}#XZff.IHH5+~Lu ùH5G+Luf. H5>Luf.H1LH5R|X1HÐH*tPH>tDH^}t9HA1LlH5{1Hf.DUHSHHGH@HtFHHHHHHDH FXHHH[]T@[/L%IH5ӕ1TH1[]ff.ATUHSHHtHHCXu9H}蠾LԌ8IH5h1[1]A\fIHH袝tHHH!CXI$[HDž]A\ff.@ATUSHGHH@HtpHIH@I@LD11莤ŅtxHCHSLH @H HDH BXS[]A\@-1LIJ1H5Rڢ[]A\1Lw@ 1ɺQH5,询[]A\AWAVIAUIATUSHHGHOH@0+HIMHSXHQXH H$HQXMtHL Ņ_Mt;Hs1HFPHxHAI~Ls`HpH HL贚ŅMt*M9tHL萚ŅLH߽faH[]A\A]A^A_DH0HHQXAE^+HCHhX>DHH ]@HFPHe1H5LsLqH1Y^cfL> 1ɺ1H5\ߠ4f.Ly> 1ɺ}1H5,诠f.LI> 1ɺ1H5f.L> 1ɺ1H5̑Of.AWAVAUATUHSHHdH%(HD$1HHE@ G\ #E1HL#2L 1-H51负LM$$H#HH9DKAAuDD9Ku(1E1LcH5ǐJ;H}E1ĹLIH51 HL$dH3 %(DS H[]A\A]A^A_H{H;}] LJ IH5%1覞HA HUHBPHH}`HtHpE1HphAƅxHt+"E1ҾHiAƅoHHїAƅH}XHtH赗AƅH}HHHL+H9u*HIUHLI9IHsHF@tH;~XuMtFHGPHv1HxHHULHRPHzHAƅ HsH}AƅHCH}H@X_HЖAƅ]L: 1ɺ 1H5QԜH}XLpD$L$ IHL ID$HL HHHEH{pHP@ooHoP oX0HS@HPHKHSHHPPHS HSPHCX[0 M|$HuXAI_H%HT$LXHdLHLHEHxPLHb Md$MLHEHHAH!PXTHHpX4HDžJH}E1ԵHH&HH5SIL1 Y^fDH}`8H) HEH@P@H]`HEHHH0LHLJL;8 1ɺ1H5qH}LIH51AD$tHEXHǀLLO L7 1ɺ1H5{L7 1ɺ31H5ZE1ڙDHHHH9udDLH%AƅHuMt"HFPLLHx.AƅHuHH HH9BHLhHFP1HxHu1ɺaE1L6 H5 L6 1ɺH5pL6 1ɺC1H5OҘLv6 1ɺ61H5)謘LP6 1ɺ1H5膘H} LقIH5Չ1VL5 1ɺ1H55H}輲LIH51T$HEXHǀL5 1ɺ?1H5AėLh5 1ɺH5蠗H}'LIH51pLL L 5 1ɺ1H5?L4 1ɺX1H5 HvX$AHDžHEXHE`L4 1ɺH5D̖Lp4 1ɺd1H5#視LJ4 1ɺ<1H5耖nL$4 1ɺH5ԇ\1ɺQE1L3 H55#L3 1ɺT1H5L3 1ɺH5cuL3 1ɺh1H5BŕH QHEތff.ATUSHwHHH9H1HPHzG^uHu=HHH9uHHHFXtHCH@Ht^H[]A\蛯H{I華H}H胯ATLSI11H5DǔXHZ[]A\HEH{H9LIHDPUH1LIH5؅1Y9@HF u@t Gyff.<AWAVAUATIUSHHGXH%RH-D$@ID$PLE1L(E1HLxIIǰI9ufDHL9tPH8uH@HxIHWIMtMHML9uMDt$LT$I w M9 L趯LLI訯LH荭LT$LHL芯HL~AWI1UH59S軒H H[]A\A]A^A_D$IH茡I@LLIIf.L8LT$@TL9H[]A\A]A^A_L訬L}IH5p1H[]A\A]A^A_Df[LO}IH5#1褑1LL2LHLHlLpTUSIL}H5‚1HXLZ.LT$DPTAWAVAUATUSHHDD$DdH%(H$1E@F@ALl$0HOHHSIILLYHLD1r HCPH5ưH8KHH3Ft"HE H@XHtHKP11H9ЅjDLAjIHٺ@^_$$LCPL1IH11HH)jHDIjDL$1LZY3AD$@H\HSXHH GHDHCPH8.HH$HlHHI>MfHL/LLdAu\L, 1ɺPH5EfDH蘩L{IH5`1E1H$dH3%(DH[]A\A]A^A_f;L"{IDHLy{1ɺ IH51dCL, 1ɺ1H57E1QD$L+ 1ɺ H51DT$fL+ 1ɺ9H5Iэ茜Ht(H{PgtH{PBf.L1ZH5~lD$LM(LsH5~14DT$Lf.L* 1ɺMH5y~+@H{PD$ fDT$ H{PDT$ BDT$ HCPHkX,HH8DT$ gfDT$ H)D$HD$ D$(D$,t$(t$(jj>H DT$ OHCPHsX,HDT$ H8+DT$ HDT$豦-LyIL) 1ɺ61H5\}ߋ f.DT$Lt) 1ɺLY) 1ɺHH5 }葋@L1) 1ɺ=H5|i@L ) 1ɺC1H5|?iH¥LVx!IH5|1 5HDT$艥LMx'IH5Q|1ҊHCPHsX,HH8DT$}fDAUATIι7UHSHdH%(H$1HIHH$t$pH5zD$H$$HD$$IH$H$HEPD$(H8D$4D$DDD$tD$HDŽ$$DDH$Ht_H}PL{HHHEP1LHH8tWH$dH3%(HH[]A\A]HL' 11zH5zDfL& 1ɺ1H5zDL& 1ɺ1H5tz[-ff.fAWI1MAVIHDAUIHATUSHI0LHH9HMHL,LIHuLIHAT1IمAWH5y @Lv11HL$(dH3 %(umH0[]A\fD1Lw 1ɺwH5ygu1HL`gH5IgL1vu1lff.fSHw@1H]HuHHt5H{@Ht,L,gIH5f1 u1[DH[?AVA1IAUEATIUHպS1VH5@iAPLftHEZYH9tpB|+9HH9tVP9wHу9rBt+AVA1LfQR)VH5hJtH 1[]A\A]A^LK Ht/XHHDh []A\A]A^fD@L끹L}h/H5Yhs1AUIATIUHSHHj LHH_nu)I9,$tH9w AEH[]A\A]H1[]A\A]ÐAWAVAUATIUSHXdH%(HD$H1HFHx@HtIIAL ŅtKLe11H5~grH\$HdH3%(nHX[]A\A]A^A_I}'IEtLI}Le1ɺHD$VLL$IE94L3L9t-I}IFHW@H9P@u@IFH9P@tyM6L9u(LQ IHdAoELAAoMANIE IF  HZHHD$ HD$HLIF I}"Mv HD$MHD$4HD$ HD$@HD$HD$HdH%(HD$1H$HtxIHAAID$HHEH@PHxAtmID$1C.HH@PHx"tNH$HtmHCLc D{(DID$H@PD)Ht$dH34%(HusH[]A\A]A^A_L 1ɺ1H5Z1eHHL[AVI1H5ZeXZz\ATUSHHPHdH%(HD$H1H{ HG`L1Ҿ3HxU)u)HL$HdH3 %(HP[]A\DH{H{Hw@HHG`H@HsHtHCHp@H@`H@HsHwHSHs HC)FPHIuIHz@#{ALZP1H5AYAT9dXZHKLH HHy@HH T ÅL 1ɺ1H5Xc@H@HÅu*Lc 1ɺ1H5Xcx@ILY11H5rXlcF[HH5DXSILUY11*cY^^Zff.USHHHG HwHPPH@H@P9tqWHx)1Ņt+HCH޽H HunH[]D1LG 1ɺCH5WbH[]fD)HG G(H[]zf.Hx tyL"Y11H5Wb`fD_H1[H2LXSI1H5VaXZHH[]fFGH ff.AUATUSHL'L9I1H-Xf.MT$ MI:I9tpIt$LHI9tILfDHH9t6Hx uPO9ADCPO9HGщD)A9FH9uH?I9uM$$M9mH[]A\A]ID$Hx@rwI1ɺwIH5U1`M$$M9%H1ۉ[]A\A]@AWHAVHAUATUSHXHH|$HHL$(HD$@D$D$<D$4D$8H9fDHD$(D$81D$0H@LHD$HHD$ L9E1DMAD@ H@LXHAEEgEwL$H|$DD$ D$SDD$I1APL\$LyTH5^TASATAVAUU_AGH09t7HAPLZT1H5#T_A^XD$IG HH[HHHڃ:t:1L TH5S^IG D$HHL9zt01LSH5S^D$IG @PEOD9t9HLSPH5QS1I^A\A]D$EODL$0DM?L;|$ t8Dl$IG A_(HQE1L:NfEOM?DL;|$ uȋD$4l$<+D$0D$4HD$9t7HAPL=UH5R1]A[[D$HD$t$09t8HAPLUH5`R1X]AYAZD$HD$(HHD$(H;D$@$HD$HL$89t7HAɿPLT1H5Q\_AXD$HD$Ht$49t6HAPH5QLT1\Y^D$HD$HL$<9t6HAɺPLT1H5hQb\XZD$D$HX[]A\A]A^A_DAWAVIHAUIATUHSHH8DD$dH%(HD$(1HD$ \IHC`@XHCpHH$+Ht$ HADžHt$ HtPH9s |$H9V1MUL>U1ɿH5tPs[XZHl$ HHM1VLCU1H5AP@[Hl$0A[A_HH9vH9hH{`HLHDHGP0MtI ML_P11H5OZH<$ADždI} H> HtAHLH<$u LV4.Ly1MẳLOH5OA@11 Z1MsL\RH5N1E1YHL$(dH3 %(DYH8[]A\A]A^A_ HSHLSSI0H5N1wYAYAZL 1ɺ1H5XNE1OYtf.E1My1LQH5N Y.@HLuU1H5MPMLpR1XY^WLXuHM1PLOQ1H5MXAXAYDT$Ht$ ELuHLIuLLH==QH1諢f.H1Mt$LWTH5LWXZE1E1L`TH5LWf.HHH=HLQIU7MLSH5YLSW_fDHLQ?IH5!L1W@LsHLIsLLH=5PH1Cff.USHHH H;C )G9w*r H[]fk)HHC 1҉CH[]H KH5KH=RK>fSHHo H;C H޺)GH[@HH9HPtHJ BHQH9uf.DHpLtlVL1H|R1HfILHt6HIXu*u"HHtHLHt HIXtHH9uHDtff.AWAVAUE1ATUHS1HPLIDžDL @IN$L8LpMHLHIFXHt%HH IFXIJD H pXIFXHHtHEH!IFXAE9oLNtAGHH[]A\A]A^A_fD1L 1ɺH5IKH1[]A\A]A^A_fDAUIATIUHSHEA$AE\tiHLtbH:ufHJ1Ht]H-A$9XLv*H IH ʃ9u-HIHt$HqXuՃE9XLwH[]A\A]1LeHAٺPLL1H5HKXZ1H[]A\A]@AUIATUSHHIEI1C\t[AT$LtR1DH@I$HH| tI$HD@YuIEA9l$Lw1I}H[]A\A]fUSHt2؉1HH[]H1HHH!H HDHAAWAVAUATUSH(t$P(HD$!@L&HD$HH@HD$HpD$D$tHgDL$1LK{H5%G~I1H([]A\A]A^A_DHD$H|$D$AD+o(t$H|$i1HD$E1LH|$DIH[DD;l$s.A^$LLI.AC EtM&ID;|$rH|$HHH9t(11ɅuHt$N(P P$H(HH9uHt$D$D$9FLD$HL$H@HHH@HD$HL 1ɺmNHD$@(D$H|$DKtHD$LfDL 1ɺ1H5EGH(1[]A\A]A^A_fDLq 1ɺdƸ2LW 1ɺff.USHHrHZHHaHLIUI1H5DCGH1[]f.f.UAHISHHOHdH%(H$1H3H\$H0HHI1J HOH}PHT$ HHEPu>HxHbz HHH$dH3 %(HHĨ[]fT$ L ~H[SH5CLHҿLD11FY^ILH1۹H5CE^@H1f`L:HIH5XC1E$f.LLC1H5#C|EtLH>u91LX 1ɺK H57BD1H[]A\A]A^A_I$H5CHB(I$B($HCHHtCH5gCHHEHHtNH$H(HD$HH[]A\A]A^A_L 1ɺQ H5{AC1DfLy 1ɺT H5SAC1f.AWAVAUATIUHSHHt H5HXLL=WHHIHgLDID$PHHxbt IHfHI1LH gHF DID$PHHHx t HD$H"H|$1ILH @HF AFL1ۅuBIHt!Ht$Hl(LxHEHHA9^Lvb؉LLH,@IHL|(?IGHHuL 1ɺH5?7BH1[]A\A]A^A_fDH[]A\A]A^A_@L 1ɺH5?AH1[]A\A]A^A_1Lw 1ɺH5V?AH1[]A\A]A^A_ff.AVIAUATUHSmHH@@{Lt6LDH5>1E1?A[D]A\A]A^HEP0Hx>r IH2HHxI}ޝHHHx:AąHLLx HHxHwX"蒝HIuLH@IE(G HHHptAąA[HH!EX]DA\A]A^fHE1%LaCIH5=1@[D]A\A]A^f1L 1ɺH5=?[D]A\A]A^L=uf.Li 1ɺ1H5F=?[f.AWAAVAUIATIUSHHoPt$ HI9t DID$ HYH1ɿIH5xPH5<1L?YH^ 3H}H跪AEH3AŅMM4$M9uM6M9HIvH}A[A_蕧uHXI~IXHL5BAUIH5;1E1>AYAZT@HXLIXHLAVI1H5w;=XZHVXH1ɺIHXSPL1H58;=XHZH}HD$ AEyHWLtIH5:15=H=HWLH5:1I1=DD$ HH}EtPKuPHD[]A\A]A^A_Ly 1ɺ1H5V:E1SL9JI49ZAߋSL1tƒA9CLwD9"ADE1E1D|-tuELDA)D΃A4A9t'H4RItF[uD9uىA4A9uD9tAG7E9Au1L >dH569H(1[]A\A]A^A_fDH([]A\A]A^A_H{{SHHHH5m6UIL=18Y1^SLAH{'SL3=;IH561p81fAWAAVIAUATIUSLHdH%(H$1HI9HI9tVL=11H557H$dH3%(HHĘ[]A\A]A^A_@LvHIH1H5LL; MD$P1LHH6HHMt?ID$PH5pWH8IHjHE1SDLhZYtvH!fL4HHIt$H>fDL1fQL<IH5X416f.M1L*<H5 4y6@L 1ɺ1H531M6`M 1L;H536,O-ff.@AWAVIAUIATAUHSH(LD$D $ȹHDH4@IEPHHxf HD$H'1LLI 1ɺ4IHHCT$H@IUPH:UH5U3H/UHDL 1ɺ=HH$NH8NAKL1+NH4$HtH肫 H4$H$Hl$1EfDMtDHT$A1LIHH@LLd+IH5!1$@H|$0LÅL~ 1ɺ]1H5[!#fDLA 1ɺNH5!w#qfL 1ɺ(D1L>ÅDT$>LL$pH5YLH5LUH5XL7H5] L 1D$L"H5QD$H\$Dl$(fDH|$03AHf5H JHNPL21ɿR1E H5_AXH<$ A9MIcH4@HD$0HH@PHxI HD$HHHD$0H5}H@PH8HD$(HwKLl EHD$pD$HD$8HD$hHD$@SfD3Ht$(H;pDHJ| Ht$(H;p$@EKL1HAO$vMIJ| 9sH4$HL$8HT$@DHAaDD$EHC@H{21LIH5 1`KLȅth1Hl$XE1Dl$\H݉DL,@N4J28 HB4AA9rĉډHDl$\l$X)ЉCL@HcD$HL$HAHT$hH|$IH@HAH4LdHVHD$pID$U H|$ LD|$C ~fDL4$H$,L赍 LHyHE蟍 E SH5LV P16YE1^H\$xdH3%(D HĈ[]A\A]A^A_Hx0IHJ|0k0SLL1AWIH5X1EA)HH}H5lJL0HL$`XZDhHL$PHAHHHH}DH5TJL0HL$P2HL$PHAHH HK H4BoJD2HD2HBo  JL0HL0MLfDH<$w uHt$0HvPHt$PHH9$8HJ| C/HD$PHJ| -/H1ɿHT$XI1LQH5R oA\XE1LJH59Lz H51E1DHH4$J| C%fDL 1ɺ1H5fDLa 1ɺ 1H5>D$D$L8 1ɺ 1H5D$jD$0Ld$hDuLDT$LzDDT$H9EAFLIT1f1ɀ?AHH9uEE1H\$EL4$LDl$(IDT$80HD$h<AQACA9GLEHqH [ILL,J|(uILJ|(ɡuAE0L #H|$0$,LHKvIHx,HLTUI H51AZA[D$L 1ɺ H5cE1D$ L<H5:1D$DT$8 LID$뷹L%H59LH5L 1ɺ H5E1HL4$HxLDT$u HLHxDT$vD$ L$HJ| +H|$0H*HLSI H5 1?XLZ H5 1D$KH|$0*H@DAVIAUIATIUSH*H9u'fHuI}xÅHmI9t@H}ÅuLJ1?H5$ }[]A\A]A^fI,$I9u#fH}wxÅHmI9ttHuI}'yÅu1Lج 1ɺIH5 []A\A]A^D1L 1ɺDH5 []A\A]A^@I}GÅt=[]A\A]A^Ð1LW 1ɺKH56 []A\A]A^I.L蹅 HQLYUA1H5 MXZfDAUAATIUHSHH?Mt L蠄 tH[]A\A]f.HLHÅLl Et HHH}ÅuHLɄ HLiAUc0fDHL藄 HL7UAO1H5 + XZH[]A\A]@L 1ɺW1H5  fL 1ɺ]1H5v 1 AUIATAUHHSHHiLCXMt9ILCXH1HD Ņt(H[]A\A]fDIH&L fIH5 1! H[]A\A]@AWAAVAUIATIULS1HH$HL$ӏIfD@tpLHIutIFHpuID$PH8HtHH<$HEHHD$Ѕu$L3 11TH5 i D$ AHD[]A\A]A^A_AWAVE1AUL-`ATUSHH8dH%(HD$(1D$L|$HD$ HD$HhL`LHD$ H$fH$MLLH L1LHsIHuˋD$L-H5 LFHD$H{PHp8H|$IKHH$$HLAUI1AWHT$H5R* H Ll$ 'E1H NLLHL1LHIHu1H\$(dH3%(H8[]A\A]A^A_La 1ɺH5; H$H|$H[HLSI1H5O XZhL 1ɺH5! I/L9twIIL1f.HEHDII9tNHe Iw1LDcÅuL 1ɺx1H5KfH[]A\A]A^A_f.AWAVAUATIH4@UHHSH(D$HH $H@DD$H@PHx L 1ɺHT$IŋD$Ll$MHD@MtLH HHD$fDHI9eHI9tfL %L1H5;L 1ɺ1H51H([]A\A]A^A_fLH+D$HHXH@HxHI\H1ɺAUI1L#H5IHD$H!CX^_HoJHHTH5HHHCHHL$I_H<$LIb M9D$;ELH([]A\A]A^A_ÐLH+D$HHXH@ f.L 1ɺH5c@HSYLQ 1ɺH5+I@L) 1ɺH5a!@HI9tHDžHDž @AWAVAUATUHSH8dH%(HD$(1oIH@H@@<I$SLl$Lha ID$HM$HD$> L:wIH501AT$LE1LHLJÅID$IDŽ$@tHEPH8舦ID$HHHÅH}PLt$M9uM6M9HEPIvH8TÅuLw 1ɺ1H5TLI$ui ubHt L+ 1ɺo1H51_HL$(dH3 %(H8[]A\A]A^A_f.HRDH LIH51Lt$M9ufM6M9HEPIvH8SÅuLg 1ɺ1H5D9L9 1ɺ1H5o f.L 1ɺy1H5?f.L9 1H5 LÅHD$M$H1IID$_ LCIH5Q1Hl$L9ufHmDL9H}DsEHUM1LÅuL 1ɺ1H59@Lم 1ɺ1H5f.fDLA1H5shfAWAVAAUATAUHSHH(kIH@H@@tEuNE@DAH߉D$衼ADžvEeIEH L5}HIH@HMELE -AWI1LAVH5H{PY^tADžHH5k-HADžADžwL׵ADžlrEEImHDDd$EDADžk1DEH1躢HADžCADžbA6@HE1LIH51H(D[]A\A]A^A_@LsPHLHL}(HD$XIuLHD$wLHD$pLL$HL$MHT$HH=1/@L 1ɺ:1H5fL 1ɺ11H5f.HhLIH5Z1@3LHxoHL@SI41H5lXZgDLH0oHLISKDLف 1ɺ>1H5 f.L 1ɺF1H5L 1ɺO1H5`@AUATAUHSHHDl$@gHDHDH[]A\A]@AWAVE1AUATUHSHhHT$@HL$HLD$PLL$XdH%(HD$(1D$ {D$ IH$HD$HD$0L`HD$ LhMt5Lp H@(D$0Ht H$HЉÅ'H_@ÅH}P1LgÅH% LoIH51nHt$ HAÅMtLHAԉÅH LkzIH51H?Å'fDL 1ɺd1H5nHL$(dH3 %(ZHh[]A\A]A^A_fHEPLH8MÅHLZIH51XfDD$ =JL~ 1ɺ}1H5KfL1OH5 L~ 1ɺ`1H5ff.LY~ 1ɺq1H56f.L1uH5\fHN(HVt$[ff.HN(HVt$;ff.HN(HVt$ff.HN(HVt$ff.HN(HVt$ff.HN(HVt$ff.HN(HVt$ff.HN(HVt${ff.HN(HVt$[ff.HN(HVt$;ff.HN(HVt$ff.HN(HVt$ff.HN(HVt$ff.HN(HVt$ff.HN(HVt$ff.HN(HVt${ff.HN(HVt$[ff.HN(HVt$;ff.HN(HVt$ff.HN(HVt$ff.HN(HVt$ff.HN(HVt$ff.HAVAUATUS9v|9w9tXIIID$PH8IID$PH8AVb1AUI1LH5XZ[]A\A]A^Ӊ[]A\A]A^AVAUATUSH`HŅHH*A9tmHCPH8AIHCPH8,HIH?AV1AUIL@H511ɃKDXZ[]A\A]A^fHCPH8Nff.fAWAVAAUATAUSHH_EC\qHHeHpHF SD9H8H(DHTAŅDDHD9VEHHt 8H萰AŅ=HCPH8HIHIeAULL1ATIH51HsXHD[]A\A]A^A_@Lw 1ɺ1H5E1fLw 1ɺ1H5DH`HIdDHHCPH8SAULUIH521E1AYAZ?DHCPDH8 HIDIHCPH8LLH=H1# H5qP@AmDL$9 H56AHDT$H1ɺ UILoH51AXAYDT$fDH߉D$dL`P IH5V1DT$HPHH@@G~L1ɅtXLl$l$HDd$Af.DH@HL,LtHxHjAD;eLrH@ LIH51E1L|$PHD$I9l$(LIDd$,$@HEHPHrHHUHHrHL9`LxB H9uӋT$LeH5 H\ID$HHHmD$Li 1ɺp fH0 LIL1 H5Ll$PL{@ fDH\$PHl$H;\$uf.HH9H{3uL@h 1ɺ H5xWHLDl$HDd$Ll$oH)D$PHxH|$`o HzHxfoT$PHD$`HB9NLfDLTHHHL*f UL$0IH5s1AZA[Lig 1ɺk H5C@H@VEu>H HH`MHHTH HH=WH1L 1SH5:AT$LLLHAADžIDŽ$H LZIH5}1HEHLIƅ1bf.@mL1 LIH5#1zHI#GXH IGXA;nLxI1H5H@HHLx1IH4HoMOHLH5L^ 1ɺ\H51E1$Ly^ 1ɺQ1H5VHL$(dH3 %(DH8[]A\A]A^A_fAL&^ 11FH5\f.Al$L L<IH501臷Ht$LHL?IH51> fHL5IH51@LT 1ɺ2H5{ٶI@IHt$8L?I>LGIH521艶@L)T 1ɺ 1H5_LT 1ɺ5H5ݳ;qAWAVIAUATUSHHHt$HT$dH%(HD$819IH@@tL11HŅH9H|$ HH<$_+ DEULE1E1fDA1Ʌu$@$A9DGEL9DL$H@HHH|HT$8HT$L$HuHH|HLzATIH51_AXLR 1ɺ1H5ٴH1_L[IH5Q1訴H\$8dH3%(CHH[]A\A]A^A_E}E1;ULHH@HHxD;sDT$ZT$uLQ 1ɺH5LQ 1ɺ1H5DA@H7H5HD$HCPH8 nHT$H2HrLDE1jE1jjzTWHjAVVR8HjRD|HPHH<$H) ULAED;Lt$ E1D$L;4$GE1u=ffD1HDLHD$7LD$ULAA9Dt$L$@HIJ| n6HuHJ| 8HID$LH5P1xZYLP 1ɺH5QI@LO 1ɺH5˯)!@LO 1ɺ1H5Rf.Ap$M6t$L;4$HL$AHHCH' H4$H) HCPHsX H5H8kIGHD$HŅuQLO 1ɺ#1H5߮8LN 1ɺH53@H{PHt$赢FfDLN 1ɺ1H5n1ŰUL|MH/LIH5!1xLN 1ɺH5Tv芧f.ATUHSH dH%(HD$1IL% H΄trH}P=Åt;LHÅtuHL$dH3 %(H []A\ÐLiM 1ɺ41H5F蟯DL?M 1ɺ0H51uLM 1ɺ91H5Oj腦DSt$t [DLL 11ɺH5[fSt$t [DLwL 11ɺUH5T譮[fAWAVIAUATUHS1Hxt$ L;IH5+1臇HELHCHI#D$XH ID$Xt+AELSEL$ 1ɺ*T~@tIHt=u5 t2t6HtHD11HH9v@ufuՉHW uuttÐGf1dDAWAVAAUAATL%USHH(LD$ H HHINj@LHD9H݆LFHT$轻tEtKEHAE1jHL$DHAAXZH(D[]A\A]A^A_f.HHHD$k HSHL$MAHT$HH=1kfL踚L̤ IH5}1.HLa>ADžL713 H5i}HLLB IH5:}1H|$(LHHLIS jLLݗ, IH5|1*WLm1H襙LɤH IH5|1~I~P LhLO IH5Z|1~H|$ADžL@ 1ɺ` 1H5|v~L 1ɺ& 1H5{P~}L0H|$HFADžI~PHH(nADžI~PXI~PC3ALE1eL~ IH5W{1}L1Lh IH5%{1|}L  1ɺ^ 1H5zV}L 1ɺz 1H5zE1-}ZL 1ɺw 1H5z}4=tff.fAVAAUIATUHSIHEPLMt"H=pLÀۅH LpÅID$@HQHAD$Lx/HL4@II$LJ|0k uwIuLT 11H5y{[]A\A]A^f.L1 H5Sy{[]A\A]A^ÐI$J|0nI$HJD0H`XÅWHII$J|0ڕH1Iٺ LH5x@H11AU{I$Y^Jt0HEPH8'ÅA|$LHiHI$J|0TH1Iٺ L@H11UH5*xzXZEHLIDLH=BH1f.HhL!1ɺ IH5]w1yAD$Lif.1LB H5#w|y[]A\A]A^ÐLן IH5v1Dy[]A\A]A^fLٟ1 H5v y[L 1ɺ 1H5vx.f.HXL1ɺ IH5Mv1xff.@AWAVAUATUHSHH_XLoPHwHI}* IHfH5wHOlHLLHIH HpI}1H+AąMvLPL\HE1HTRH @HH9tH9luHL|HH9uMI}L~AąI}HgHAąIFXL%H EXH"HEXAąLÑHI踑H`1"IمL}H5t@H11ATAvXZ5fDk LJIH5]t1E1vHD[]A\A]A^A_H L?If.LLIH5s1AvL 1ɺ 1H5svafH蘐 LߞI(L 1ɺ 1H5nsufKLIH5=s1uLE1 HHHH5rSILo 1FuY^L 1ɺ1H5ruafAWAVEAUATIUHSHH$T$L$8DD$HD$0dH%(H$1LHË@L$D$ uHCHt$HP 6 DAͅ)Eu C8$HU<$@$D$u#D$uID$PH8kHUD$HsL{H~@IGPHHD$(H(HM(l7HU(LHT$@aH1ɿHT$HI1LH5KqRsLSAYA[IB HHEHE1{LHHFH|$(.IH H9tvHD$@HP(HHCHT$(HxPWHT$(LM(1L(H5pRP1rLM(Y^L,1ɿH5kp1rLT$@EHCLD+xE1HsLH{HY@HDxAv&Au HsHHSDkLf.Et A $t9$t A LCL}(HULMHIp(LD$@LLL$(j ELL$(LD$@CLAPAm9eXA]D,$A]CL$<$@WA@1E1LSH5ouqL 11H5nTqKL@u9)AEf{LHHAw?IOPH HL$(fDLm(HHLhHLm(H{H9AUL;UI1H5&npXZL5eAD)D9t-H{L1ɺIH5m14pHCLHAu3Et.H{襊L&1ɺIH5m1oD\$E2Hu(H=vLsHULI~Iv(hI93A>LDHCH@PLHHx蚠 IHH9kH LepLLDL p1LH Hr VHM(H{HL$(謉HIHL$(LLH1\IHfLT$XAf7ALEAADHdiHHHEAFLUAu9)ЉD9m fLD$hHXH$H{tu t@  HUHL$PHs(`"H$DpLECDÃA9G@S$T$LHt$P8~Lv<H$It$XG5fLY 1ɺ1H56ceL8 1ɺ1H5cneftA8Hu(H=HI{Lk AAvEzEH{LT$(zHHAWH5nbUILV,1dY^LT$(fLL ϜDI HHcхbƍHHtQ@LǍHHI HHcхuA{L@H{A~HHHLDUI1H5bacHk_AXHD$ A;D$A;AFLUAu9v)D96MFMH2HHLEAHH5Hu[HHLHtHHH4H3HE1IHDy@1ɺE1Lb H5H`b#LI 1ɺ1H5&`bf.L 1ɺH5_Qb$MfH$H@HHD$ H$Hx|L> IH5t_1aFfDLi 1ɺ H5C_aLE 1ɺ 1H5"_{aELb1D H5^IaĀE6{LqH{{HHLqARIUH5^1`_AXILb1&H5[^`2H{6{HH{HLˊIU덩 Hu(H=tHE E1LzLt IH5]1`1A@LH5]_L 11 H5g]_;Ld 1ɺ 1H5A]_LzLqsIH5]1f_.AHCH@A ^H#E1HHEH $|$ ; |$9A9I89$LHt$h4=LTyHILj, H5@\11^|$hG1111L {+AAu A  CLA EzD)A9 EH{xHHD$@AWHT$HIH5[1RL~F]XZL 1ɺ#1H5^[]5HE1M$t$L}AAF89$D$A;sLw H5ZAPI1SL^3]AYAZf.D$d9t5LA)wH$DL$dLEHSD+JAV_ PMH$H89$ID$P$H8[yLHD$P>wH<$HD$HHD$@H$p8ID$PH8'yHD$ 轿1H5Z@H1HL$XQHT$X1RLD$Xk APLL$@L:\H LA9WfDŽ$HHD$ H@)$)$HPt AHD$ HT$xLH8L$@HL$|]j4  HD$ H9ht)۾L H5%Y11w[ID$PHL$(E11ALH8ou11Zj.HL$pDL0+HD$ P(HpՋFHFu9)F)l$pA$HFu A9D)Љ|$p)1HHL$HHHHʼnHD$(ID$PHH86wHL$HHD$PID$PH8HwLHD$Ht$H5pL RHT$XLDLH5WRHL$XQ1P1ZH 11LH5WY|$n *LL$(LvH5lW11YLH5FW11YL tE1ɺWLH5WP1jYAXAY|$8 |$u6LsH|$ HDHH=)H1膣HkIl$XAXAY1LDE'LE#uKL n qH5QIL!1RSHL$01L*ALm wH5PIL1SHL$011L*E;uL$AE8Il$Xt/ID$Ht%H@ H@XHtHKPHM=1H9ЉÅtH:=J1۹LnI1H54yb/[]A\L0LIH5y1)/@@HH H  @x}=@x}NиH)AWAVAUATUSHH8dH%(HD$(1HGH@PL HD$ H{ALHH{HT$ \YHT$ HBp8D@0 ȉ ȃD Ai@BO9jBD99HBHH90HHb uHT$ HBHHH;tqHH-RC6 H{LHwHDHD$ E1H@L HHK1UILnAUH5#w1ATM-HT$@H H:<] H\$(dH3%(D>H8[]A\A]A^A_fDHBELvLDH w@HDHv@HDL=vLD$LD@H{HL$L5vHT$LD9GHLD$ IH5^v1APHL$ LkQHT$ 1RAWAVE1g,HT$PH0HB@8*LE1GLIHD$ pGH{HFAU1ɺ?UILXl1H5u+HT$0XYfDLEGLIHD$ p2GH{IFFAV61AUIH5nu1LskE1+HT$0^_B@LFLIHD$ pFH{IEAWLj1AVI*H5t1E1$+HT$0AXAY fDAL 11H5t*""fAWAVAUATUHSH8HGPHWXHH$HL$@H%HD$1HD$ LHAdE1D$,I9I ILgXuH|$HID$VH|$HDL$IWE9ELA9DOH;T$t=HHHD$,HL$ H9tfHpHHvHH9uHEPM?HI9JH;\$ HL=jx;H9HH-sHD$,Hk L%>H|$HHT$EULj1AWHT$ IH5r1RAT )H AcEH8[]A\A]A^A_H|$HD$1HHL$ HHHH9tf.HPHHRHH9uH9\$ sHEPf[HHD$HuHD$ HEP1聋1LiH5q@11(Ac~5O1LjH5q@11'E1LajH5q@11'H}P9H9sWHu,L=;=H-q#H|$L%=BH$L=hHkH|$HCHAc EGHD$ L=<fAVAUATUSHoTH9r%1HHuA[]DA\A]A^fHHI@AąuIEPHH8VCIIIEPH8@CH{H$ALHAHLiAVI1UH52pSZ&H D[]A\A]A^f.UHSHHHt&H莐HHtNHXHH[]H@LapIH5o1%Lq 1ɺ1H5~o%DSHWHGBHHH91HJH9BH9uXw.A1 LoH5n'%[11LoH5n$[fDH1v?LZhIH5n1$[`ff.AUATUSHH8dH%(HD$(1G\ AXH fE A)HZE1HHHHH9t\}tHmHCPHE1E1HH8#8H߅$訧HHCPHH8YŅ/HCPHH8HCPH8E3DCHCPH8W!H'H˘ H{P"t H{Peu#L 1ɺ\H5l11"HT$(dH3%(H8[]A\A]DS=Lf1IH5sl1"HCPHH8豋ŅH?XŅ?DL%fF1H߅HLDLH(@%jLdYH5@[nE1[fD$L 1ɺDHH 1H@AWAVIAUATI1USHHdH%(H$x1H|$PH|$HHCPH8NHHD$PHCPHHx֨HD$HI $H#HD$AL$HD$(AF4HCPH H8҃),H1ɺUIL[1H5a&LD$1YHa^龀MLLD$ LD$AoIcHcLDPAF IIOL==v =ɃKL1LD$ HgaLL$O LL$LD$ EA~7LLPAot@OHCa1L L 1ɺ-/HcLlPAoHCP1ҾH8ZHH@ Hu2HP:t HcHTPH@H8tLZ<H5:`1E1H$xdH3%(D HĈ[]A\A]A^A_fDL$H龀1IH_H L 1ɺx4Hl$XAHD$HD$(@L 1ɺH5_1E1 EHl AŅaHD$HcHt$1L=SZHDPHD$@H$pHHD$HCPH8LIHLt$8%f HCHt$pLuLHHI<$u1LLHMuHD$8H4HCPI4$H8)HW1PLL$H1LYH5[^ XZIf LϾLD$ H`^1LL$[ LL$LD$  L2 1ɺ"lfDH&LXFIH5]1A @H|$QAŅ-I $HNH|$(AZLCPH1AHHH9:I8Hy(LY1ɺrIH5B]1 HE15&LVIH5 ]1~ fn1I_L H5\@11A @L 1ɺ&DLVE15H5\ LLL$PL\1dH5X\ LWiLL$PLW1MH5\ ff.@UHSHHHL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H3H$IH}HD$IHD$ H$D$0HD$sx/HHcH9s$H)HMHHt$dH34%(uH[]ø@AVAUATUSHH $HPIIIdH%(H$H1H\$@P MAHH0[1H 91H1 ŅII?LYqA$HL11A<$IEAZH$HdH3 %(DHP[]A\A]A^P MMHHZ1H <1H18Ią+8E1 I1PHGLo PH5wY1_AXELY1ɺH5LY1E1A<$I1PHJOL PH5Y1zXZA<$WI1ɺPH= L PH5X1E17Y^I1ɺPH\YL~ PLY1ɺ#0SHt0H$Yt$AL:T11#H5;XH[ff.HZHcH>HkHXHXHXHXHCHHA11LS:H5nWHHff.SH%t;H"Xt0H"Xt$ALvS11IH5WH[ff.@Ht`Hz tUHWtIHWt=HA11L;SZH5VH/ Hfff.@HG\H@PH‹XHHwHHH9t"1HHHQ$H9u9\s\ff.fGNA1HHI1HHLIH9HGH9HFff.AWMAVAUIATIHUHSHH(H $dH%(H$1Ih Ah(HKPHSHLHH' HtbHT$LLIHT$d tvH$xIGH$dH3%(+H([]A\A]A^A_fHLQIH5T1$1HHt$I1LeQH5wTX1ZhH$IOH`ULpF>H$IOH?QLp$H$Hp Hx IwAG HI+ HAG$WHSP\HIGH<b AG(t@AWAVMAUIATIH5,CUSHH8L$ dH%(HD$(1HGPHHD$ HHD$DHAuIHHƃDHt$ L?j |$ ;cNLgP1ɺ1H5R]HCPHH8>kHL$ K6H)HHL$ H91H|$H SHH1AEHHHAo$LxAoL$,AoT$ <IT$0HLAT$8DXTAU\HKX@HmX?HL$(dH3 %(HH8[]A\A]A^A_DHC6HHt$ HH5Q1LRI1$AuHHD$ H)H1HHCPAuHH8zHD$c1LL$H5CQLiN@11AuAMHCPHH8Ht$ HHCPH8 HL)OUI1H5P1;XZ@HT$ LHHL'NILiN1H5WP;Li 1ɺ1H5*Pf.HLMIH5O11_f.L 1ɺ1H5O/f.Lɛ 1ɺ1H5O1e3UHSHH5uHHuEH[]f.H5%PHuEH[]f.H5OHQt%H5 H>u*E@EH[]D1IٹLOH5N 1AfAUIHATIUHSHMHiLNHC4SLOHC5=LPHC6'LQH 蒽LRHCLTHCLUHC7VLVHC ûLWHC谻LXHC蝻LYHC芻LZHC wL[HC$dL\HC(QL]HC,>L_HC0+^HLChH{8H,LH`oHIEH[]A\A]L 11ɺH5L%H[]A\A]AWAVIAUATUSHH8Hi6 dH%(H$(1HCH$ HD$hHL$XHHL$pHHt$HHHifHH Ht$sHHiHHH H|$HwHDHD$CH5H=`ML$&HD$HD$HD$HD$(HMH$HD$xH$HLH$H$H$HLH$H$H$HLH$H$H$HLH$H$H$HLH$H$H$5HH$HD$ H$H$HD$0H꾀LH:LHLhLL)H wH|$ LS LA1ILfN< H|$0HT$HIHL$8LLL$@HL,H|$ IEHHD$PHL$8HT$Hx&LL$@IOL9rLI8I9vMfDHH$Hl$xHHHHH$HHHHHHH9HFH$H II HL$E1{DCHA1H|$A1A1EAEH.H|$sOsHD$(LLHH H9qHLHH1UILH1H5HEXZEAH$(dH3%(DH8[]A\A]A^A_MILIM LH$HD$0L;$HL$0ItDEtiMLF11bH5H<LL$XLI11H5GATH1ɺdPLL$`LYI1H5GAYAZ@HLHHH5nGUILF1Y^EY1LL$XLIH5&G@11E1YDH LHt$hH|$pHHH1@EWH LMcH7N<Ht$LHD$H LD$Ht$hMHH|$pHE1U@AH=7HsLIcL LL$ uHt$LHD$H _LL$ LD$Ht$hHH|$pHAE1*DE|$HԬ7H3LIcL LL$0 Ht$LHD$ H LL$0LD$ Ht$hHH|$pHD1oDHH$IHH$H$xLC1ɺ*H5WEPH$xHPH$PHPH$`HPL$X1I$H$hH$XH HHII dfHDIE1LLIHu H9wFHf.ARWLFV1H5KXZ1HARI_VLFS1HEHLHt H@H9CtdMɺPHWKLDH1SLEKH5&KuH{8XZHtEHPb H{[O" LIF1[LH5J#AUI(ATIUSHB! HxHHi& HH]Mt,LH% &LJHHHLL+HHkCP` HPHH g Hf Hf Hf Hf Hf H(f H8f Hhf ALHILIMH5ILDH1SXZHH[]A\A]@LD2H5LI1H f.LD1H5I\HT fLD11ۺH5H*[DHt7SHH'}t[ÐH{@H{HH[Dff.@SHHwHHPpHt&HSPHHe HkX6[fDL) 1ɺH5Ha1[ff.fHGHtH@HtHp8H" D1DHH" ff.HHHHHD" ff.HHeHHHD~" ff.HH5HHHDN" ff.HwhHxff.@HHlff.G(HG`Hff.Hff.DDDDDDATLU1SHL9tH{HL9u[]A\fATLU1SHL9tH{HL9u[]A\fUSHu H1[]H9wH11DL{kH5HEXZH[]@UHSHH{u?H{ HtTHhHHH]Pa HuX6H[]Lщ 1ɺs1H5DDL 1ɺvH5DH1[]UHSHHGHx b H}H0b H[]ff.ATUSHGHX H H9t7I1fH訠HID$H H9u[]A\f.1[]A\LDHH iff.@ATIUHSHWHZ HB H9t=DHCH@`HtHIT$H9HGHHB H9uHtH[]A\1[H]A\fDHLA1 L ?DH5 CUHff.HGXH5HtHpH ff.@UkLSHFH!GY u-uyF=H[]fDt@tH4sLK>I1H5#BmH1[]@Li>{1H5AUI1H5AX1Z@HjLA>I1AWAVAUATUHSH(Dm9yHEHxZ9H}HGH@H@PHt HЅ%HHADHHHADH@HHHL$HD$H9 HD$LhALlIADH8H)LkIADH}@HzMMM9u xM?M9tpI uLkIADHA@HL`kIADH*@HuD$L 1ɺ.@HD$HHD$H;D$HHHT$HD$H9HD$ADH$L`It$HI$I$I$HD$H9(It$HH} ADHW?$It$HH}$ADHF?It$HH}PADH3?It$HHADH?ZBIt$HH\ADH?4ELE1tZDHL<@ILu#It$HHzADH>AD9mLwHmH;l$HD$HHD$H;D$rAH(D[]A\A]A^A_LL:1H5k=E1붉D$LU 1ɺH5C=1DT$@Hh1HHLI:1H5<DE1B@D$L݁ 1ɺ@D$LŁ 1ɺkD$L 1ɺTD$L 1ɺ=D$L 1ɺ&D$Li 1ɺE1L|H5<<E1HzIt$HADH<HHIt$HADH<J|8HD$L̀ 1ɺ sD$L 1ɺ\D$L 1ɺED$L 1ɺ.D$Lq 1ɺD$LZ 1ɺD$LC 1ɺD$L, 1ɺD$L 1ɺfUSHHHCH@@XtuH[]ÅH9sHHH4L(8UA1H5r:X1ZfDL1L7$H5;:H1[]@i1L;,H59H1*USHH txHCH@@Xtu#H[]@DA9vHP1L7H5j9X1ZL1L37@H5;9H1[]@y1L>7HH58H16t9wPt wPfH1[LH581HfHt>uHLJÐSHH HHHt[D1L6pH5*8t1[UH/HSHHHHHDH HHHt H[]1Iٹ}L8H571ff.fUHSHY HHHE`H%HwHHೃzCtHHൃxCzjགྷpC}PHC9tCcHH[]fDH蘟຃sCHH[]L1H56f.AWAAVIHAUATUHSHH*bL7Ht)H{@HtI3T AątH5,1A\fDHEH@PH8`L-1ɺ6IH5,1ATIUHSHHtaRLHHÅt]HLHÅt[]A\f1L*H5-, []A\D1Lk 1ɺH5,[]A\AVAUATUHSHHĀdH%(HD$x1etC>=t7Ht*>=HL$xdH3 %(H[]A\A]A^DLt$Ll$ HLd$MM==LH5:==tLLH=L{l|$aD$ t==JHl$ PH01HL$HT$HLD$H51 ׿|$|$|$tUHSH} HHtHHH[]ÐL9)1H5=*f.AWAVAUMATUHSHH(dH%(HD$1H?L|$`Lt$hHT$LHq AątrHD$HPIHIHxH0MtAEP1HHA裰 Ht$HAE HL$dH3 %(Du[H([]A\A]A^A_Lh 1ɺ1H5H)'DIHHLL$LL$I$.:f.AWIAVIAUIATUSLH(AhLH1Ld$`LT$hHT$pHHC0% HLCKPIxP9DAK E_LT$Ht$0Ht$SPLH AIHCAH@PLT$AuALg 1ɺyH5(1E1RDELLe =HH=L1H0;E1IHDT$',DT$C1 u,:=AtDT$ ,DT$wAEAL1DL E1AdDL$Lf 1ɺbLCIxPHucE1AMHHLD\$LLQD\$H(ALHL[D]A\A]A^A_f1KP9AE1۽sHsHLFY HEH9AIHHC$L%LHHH57&1E1@LLHL$HT$LT$~HL$HHH{LLT$HT$D$Lee 1ɺiH5%1DL$H(D[]A\A]A^A_@D$L%e 1ɺ|@8=C1 Li$1oH5E%$E1Ld 1ɺJDHL8$LHHH{_Lh$1ɺ1IHCH5$H@PH1灁DŽHCH@PHDT$.fDUHH5%HSHe t H[]fH6i L$EIH52$1H[]fDUHHSHHHtlHq8HHCHC H^HC(HC0HtHKLK(L/ 11H5#{HH[]ÐLc 1ɺ 1H5p#Of.AAIL9sWHH $H3xDB3sH-̛8I²HL "PH PL 1H5"U虾H |$<uA<$kHL ]"PHLS PH5!1UBH *tH=!1!A詴HA1赬=1DëAƃ$DH-般b|$w;許L AQL {!PHMPHPH5 1|H ;聮8ZATDzPH L "!PH9L9 PH5 1.H LZ 1ɺ1H5  돿譫;ްL APLͮ PHPHP1;詰UH-XPH[IPL U1H5肼H D&D;WL LM ARPH PU|$ |$ ЪI<$HL裫;M $H HژLڭ A9HDQPHaPR4;H-a襯IDASL PHP PU;{L nLq VPH!PHTP;GL 3L= WPH PH Pf.SHHH?dH%(HD$1,}IMDHL PHH5P1ATH LM 1ɺ1H5cү_L.1H55褯1ڦf.U1ҹfSAH5LsH8dH%(HD$(1fT$f $1D$HD$D$(1HWtz軝uHD$(dH3%(H8[]@s8̢HL sPHyL PH521AQ袮H @!8zHPL HvPLZ H51AQSH 8腥DSH t7躤8u41IٹL*H5[fDۡ;IٿH HŠHDHL PHH51P1R衭H [fDoFhUIHLSH5/H8dH%(H$(1:t:ӛH$(dH3%(H8[]f.HH`uH$޿舞uH$H9D$uH$H9$yH{i8w1I5PH^ H5PL 1ZY^)ۢ848I1PHL PH51XZKff.AWAVAUATL%=USHL5=IM9xAHL-dyfMN1L1LST蟫A~ aAvI~I~蓝L苝HHIL9HHtI~H菢uLs! EjAFLL%D$IFHD$I1|$蝙ip8ɞ(1LPH|L,~ PLL$1讪XZ++8脞MN1LPVH0PL} 1jY^H1[]A\A]A^A_H[]A\A]A^A_@AWILAVAUAATIUSHH5HHdH%(H$811҃" P1TRRrL_AXIH$L|$HD$cfBL1茝Elj=A>… LLСE;xtA>1MuPHH5PLn| 1Y^T@{;貜A>D$<$<$T$WL1H5>蛨;D11ɺL&F H5e1H$8dH3 %(xHH[]A\A]A^A_f.HT$3ߙH$H9D$H$H9D$f.A>țM1PH{L&{ PH5K 1諧XZ@A>舛A<$MH +HmHDHLe PH H5 P1RxLH 1A>(A<$MH ˼H HDHL PH H5 P1R;H 葕Mff.@UHAWAVAAUIATASHH(dH%(HE1E踘HHH@HH%H)HHH9tHH$H9uL|$HHHMIL:HMHuLL:auxADt$At[uLpDLHH]dH3%(uTHe[A\A]A^A_]H)HLef.DLH]uLEE赜D1cAWAAVAAUATUHSHA*AAt:1E1L H5 HD[]A\A]A^A_ÐD$ RA L$ DH=L-=DEL9uHL9LsHLݛADžuރ|$ ML H5 1Ƀ" PDl$1AUL{DZYWA)@H[]A\A]A^A_D$ WA L$  艔LA 1ɺHHHwIHCHDt$ CL H56 A1Ƀ" RD$P1w^_HD=HsEDDHA11zEHH== DH0L@ 1ɺH51E1kHIL H5SP1譢AYAZ@L$ DHaAFfH{藔H菔L@ 11H5NFfSHH== H1ҾMf[=D=N8D=z#=Df#=Suu U#=[L91ɺG1H5诡)#=[=#=D="=D="=D="=D="=D="=D="=D=~"=D=!=D!=u=`M8ff.=!=D=6M8D!=u=!=ff.=M8DUfSH)!=)!=)i!=)r!=H!=Hl!=H L8H;(AH=*!=1 t]t)u%H(H5L8[H==!=]g uwHrH1[]H]u̸H[]1ff.fH3HfDHATUHSHI踂HH]HՄtdHUYtI 1$@Is9fI|$A $2IHJt LHAxuҍy@4vL@L[]A\Dff.@SHCHuNHIMu [Li1H5<1[ILf.SHHt [DHh1[H‰ff.ATUHSH~LHH襂HuH L9u[]A\f[]A\fDUHSHHHt+HHH5a H HHt.HH[]@HHT$SHT$tJH, 붐H蘨LTIH51HH[]HHT$uHHEXHH!H9tH.HB9H/HV'H4HH%rCH&H H'H@uHT$HHHHHD f.USHHXHt$(HT$0HL$8LD$@LL$HdH%(HD$1HD$p$HD$HD$ HD$H-f.ƒH$HHt.HH袀Hu$/vHT$HBHD$HHuHL$dH3 %(uHX[]蓃ATIԺUHS蘘 tDH_'HHt_MtHxL1\u E[]A\Lg11ɺ2H5y͋[]A\fD1ۉ[]A\SH=H;Ht7H[ff.USHH=H8Ht/2HHtzHR{H߉(yH[]L1<H51L1KH5H[]DL1AH5輊f.USHH-=H}tH[]f.H=} 1ҀHuH|HEHtÅuH}HE뮐L"H5 ff.H]=HÐ}AT1IH=UH1S}HLlj+zH9u߻Zx[]A\#8|}HL PH Ld{ |PHPfH5?P1LH wÅt11L& 1ɺ~H5[]A\Ð1ۋ8|HL $PH Lz wPHeH5P1ˆH []A\1LW& 1ɺH5菈[]A\ATIUS)@L~1҉)9w[]A\ff.f1fH=r HƅH(\(HHcHEHHHHÐAUATUSHdH%(H$1HtW>/HIHH8IHt^1IH,HLO tbHLtMDH$dH3%(uEHĨ[]A\A]1ҾAHI8HuDHHLz S~UHAWAVHAUATSHhL5q=dH%(HE1E"}HL-L=HHL9IIEHHH%H)HHH9tHH$H9ut H)HL_H\$HHJT+H9sf.HHH9wH1HxE)E) u EEKHx见L=h=DLqvIHcLMu.HxrD;}LIwL==DKt=LHI9s@HHH9wL==H=IEL11H5,uIH=Ht'I$xH@I$IL9wtE1LfK|IvD9HEdH3%(uTHe[A\A]A^A_]>uIH=Hx뙿uIH=HY{DAWAVAUATAUSHHD=dH%(HD$81EtKyHL$8dH3 %(sHH[]A\A]A^A_HHHE1HQ48L-H==HI9q==11r|HH48E1Hu#HH38IL9vH5===L)LsHuH38L9pL-=1H߾CD5YNE\$H huHD$H:HDDd$HD$ LxIH`HL$0HT$(HLHD$,AH5PHD$3PHD$:P1LL$ALD$@uH |$ rLcd$$H5rMLyvHyH5^LavH<H55LIvHRH|$HD$Lx Mt2fDA?uI_;tHLvHMMuHT$0HD$(H5L_II)L}ATL$+QL$2QL$9QjrRLHPIHIº,H PLL$P1uH@L$LH|$(_u{MnWHH18Hn{HHn=hf;yw8tHL PH Lr NPAQSw8tL =1LT PhH51AU葀AXAYIw8at==H HL]HDHDPH L =PL1r RmH511H v8sHL PH Lq IPAQM1L!H5D$]HAULL$ LyH5q1~^_'Dd$HL JB \$LEH5'LEHu1.XZL1ۺbH5 y|u8rA}H [HyHEHMPHLp PR5H51~H D$8H67L=H77H9|L;HLL^rHtAULvAWLL$ AULSLL$ {H AULPLL$ VHH`t8qA}H ZH]HEHMPHoLo PR0tfDSHgKD =P=LH53P=P=P16}=H u==t[D~=1p1Lr1ɺH5|6=tB=1H<HOuLT 1ɺ%[H5||1ҾH@=u=<u'H@"HH=< 1H=<1/p=ar8p=^<H HXHDHL A<PHy PLm H51R{H [LX1[H5{ATUS = r11H;lÉ =tD% =D9R[]A\D}t,oLN 1PHL ƐPH51 {_AX[]A\11Ddnu8HAٹATH5LzY^[]A\fD}nHE1P1LH5xzXZ[]A\Ë =t =  =tS =11mtJp8.nHA1P1LH5zXZ} =[AٹLQH5y[D =ff.@SHHdH%(HD$1蓟VD  =P =L/H5_P =P =P1byD =H Et =  =t$HD$dH3%(H[f.1ɺ,H51LH$xHHt3D 8 =EtORH=K =j4 =sLY 1ɺ/H5}x= =-gurH= =jH$H9<H =zLL u<H$HLH9suH1RH5L ;xY^0n8kL`K 1PHL .<4PH51w_AXIH1RL?H5wXZnff.fSIH =uH H=i t@L)1uH5,w =u =H[HLL$DLL$1LrL =H5vHHfD& =SHt 虜tEIٹ1L`H5o~v=~ =[fIٹLYH5,=1vff.@=Dr=D^=SHDHD O=AtQ1L;H5uH5#=t [f[ f.=~L1H5SbuD =ufDD =SHEtHt <E<H$dH3<%(WHĘ[]A\A]HL$LL$ LLD$H55<+É<T$H\$L%Lkx9r6tdLK0M1H51HkT$L9t9sʋC H C<L9ut1 2<H@C9D$wuC9D$ sfD$t uD$ uL 1ɺ=1L;H52kDL 1ɺ)1H5k=bff.fAWI1LAVAUATIԺUHSHH5H(dH%(HD$1jHT$LHÁ KHt$CL9F HHZ:E1DCLAD9HDE1E11H@Ll1IEPLH8l~ADžuL蝄LLIH51iHt$j1E1LH5iHDKLHD$H5bL@ P1|iHt$ Y_H蝚 HL$dH3 %(D9H([]A\A]A^A_AL 11H5if.E1D$ /Ht$HF0B<(DuIL$XD$ AD9sL|HEE1E1KDm1H1L`ID$PLH8|ADžuLLIzHt$AUD$ AI|$P1RHt$AX_HH51 \HHff.AWfAVAUATUSLHH$@H|$L|$pLHD$dH%(H$1)D$0)D$@)D$P)D$`HI@@@-{L@ HCHh eHHBdH E11E1E1E1AIIH\$=fAAE@@u\Lt LHI Ń9KHHH@Xt LHH LuHE@Hu=E!@tL11xH5.Zf_DAAbI1HT$,Lt D$,H{覀MLIH511eD$E11E1E1HHD$pHCPKLD$|)щL$xH@ uUHl$0foT$@foL$0D$$C@)$$CD)$$D$$C8H$HLL$H|$$ ŅDCLHT$1HH|$HH$dH3<%(qH[]A\A]A^A_HCTLLHHf.HP CLD$|D$x;@H\$E1CHD$AfA@11Lb^H5$d)L 1ɺ1H5cf t:CL$D$x9LHHeLfDSAHCLDT$ HXHC ILSPH51`Y^DT$ H$dH3%(DHĨ[]A\A]A^A_D$ HCLHXH HLIS널IL1PH5]_L1H59e_E1JE1D9v)M{1LO H5._룃H{v'AHG CP1sLCPSH{MV1LYN H5^2Mh1LH5h^LMoH;LN MLDHAWL 1ɺsH5B^L 1ɺcH5^TU@UHSHHHGWLH@ 1H52HJHC@ tS8HC@t S< S@SDFSHt"H5HDuH'>@1H5dH7S8u0HCH9@H&HDHHH[]54D1H5&HOuL 1ɺH5\1H5HL@ 1ɺH5Gx\1H5HL 1ɺH58\efD1H5HL 1ɺH5[%fDL 1ɺH5[H1[]1H5HLP 1ɺH5W[fD1H5HL 1ɺH5H[rL 1ɺH5![K@1H5 HwEL 1ɺH5Z L 1ɺH5Z@ATL%UUHSwL1ۅAM1ɺ!H5F1pZHH謗9]LwHHtcMLt\1L%fHH@HDHt)HpH(1AM1ɿH5YXZ9]Lw[L}o]1ɺ*H51A\YSHH#w,t [LO1KH5FrY[ff.AWAVAUILATULSHHHdH%(HD$1HL|$PLt$XMp H$HPIHPIHpHx> AEHt#Haw̫UPHHHHHH4$HA HL$dH3 %(Du;H[]A\A]A^A_fDAL6 11H5@lXODAUIH5-ATUHSHdH%(HD$1HT$$D$HH5HAA t@tupD$$AAEHL$dH3 %(DH[]A\A]DHL8IH5g1WHE1}L>IH5,1VWjNff.SH#Ht~LHIytn unD@L1EtAHA@1H @HBH H:uHRHRXHHH9uAuEAA9[f1[@HpLAEHE11E1҃tHD9th1AHRHNjAt׃uH@H@XutAtE빐H@AH@XuHIAfD[ÐAWL=AVIAUL-p8ATMUSH̏H1HHHD$OfDAG ML<" 1ɺH5^C1UHLjÅIM9twHXMHH|Lh Lx(IGHHHSH$ sHjHKHYH$H T$HC0HSCHGH[]A\A]A^A_fM1L:H5}T4@LI 1ɺ1H5STf.HH HFHFff.HFff.HH HFHH HFHGPHFff.HGXHFff.HcGtHFff.HcGxHFff.GpH HFff.HH HFH HFHFff.HFff.HFff.HFff.HFff.G(HFff.@HFff.G(HFff.@GHHFff.@GLHFff.@G8H HFff.H HF1HFfDHHFff.HFff.HHFff.G HFff.@G$HFff.@GHFff.@GH HFff.SHWHHHHRPHz1HC[fDSHWHHHHRPHzHC[fDSHWHHHHRPHzqHC[fDSHWHHHHRPHzAHC[fDSHWHHHHRPHzqHC[fDSHWHHHHRPHzHC[fDSH3HC[SHsH HC[@SH3H HC[@SHWHHHHRPHzaHC[fDSHWHHHHRPHzHC[fDSHHH HC[ff.SHǰH HC[ff.@SHH HC[@SHWHHHHRPHzHC[fDHHv?cHDSHbHC[fDSHsbH HC[@SHsbH HC[@SHaHC[fDSHcaHC[fDSHbHC[SH^HC[SHc_HC[fDSH_HC[fDSHHHC[fDSH]HC[SH]HC[SH3]HC[SH#^H HC[@SH]H HC[@SHHHHlHC[ff.SH\HC[SH]HC[SH\HC[SHCHC[fDSHHC[fDSHHC[SHHHHHzBHC[SHH HC[@SHH HC[@SHSH HC[@SHH HC[@SH#H HC[@SHHHHHzBHC[SHsH HC[@SHHHHHzRHC[SHHC[SHWPHHHHz5HC[f.SHWHHHHRPHzqHC[fDHH1E1dH%(HD$1HGPHL$H8itT$H|$dH3<%(uH @f.SHHHC[fDUHSHHdH%(HD$1HGXH0ruH-r^H%1HHvH$XH8?x HcHEHL$dH3 %(H[]H蔾 u@HHtuL 1ɺH5GHfHCXIHh@LI 1ɺH5.GH9>SHHdH%(HD$1uHT$dH3%(u!H[@Ht$HftЋD$T>@SHHHC[fDUHSHHdH%(HD$1{HCXH0rpH-H$H%1HHtH$XH8sv HcHEHL$dH3 %(H[]@HHsuL 1ɺH5FH롐HH@H脼 tHCX:1HH#uILt 1ɺH5YEH0H$L= 1ɺH5"uEH<@SH3H HC[fSHHHC[fDSHHHC[fDSHWPHHHHzUHC[f.SHWPHHHHzHC[f.SHWPHHHHz1HC[SHWPHHHHz1HC[SHWPHHHHzUHC[f.SHWPHHHHzHC[f.SHHC[SHWPHHHHzHC[f.SHWPHHHHzuHC[f.SHWPHHHHzHC[f.SHWPHHHHzHC[f.SHWPHHHHzUHC[f.SHWPHHHHz5HC[f.SHWPHHHHzHC[f.SHWPHHHHzHC[f.SHWPHHHHzHC[f.SHWPHHHHzHC[f.SHWPHHHHzHC[f.SHWPHHHHzHC[f.SHHHdH%(HD$1HGPHH8¹H$u1HSHL$dH3 %(uH[d8@UHSHHdH%(HD$1H$3uOCZu)1HEHT$dH3%(u?H[]HHH$Ht@ @HHUH$7f.UHSHHdH%(HD$1H$蓷uoH$CZuUHHt"Hph R|$GH'D$6fDHHL$ HL$HCXDHHL$CHL$H@H@ HCX'Hl$HHP?VfDH֋QtA yH HQ ff.@H֋QtAyHh HQ_ ff.@HHq HHdH%(HD$1HT$D$D HL$dH3 %(uHzf.AUATIUHSHHdH%(HD$1HAXH$u~H r?HH51H HL$dH3 %(unH[]A\A]fHtHCPIHLH8tLHL} HAPIHLH8ӓuHCX`ATHIUHSHHdH%(HD$1H$[CZu=1H50H HL$dH3 %(H[]A\f.H踞HH$HttH1H fHH5H$H5B L$ H5i618jf.USHH(dH%(HD$1A\tHHt$H}Au11H5/H H\$dH3%(u'H([]@HD$HT$HHHD$ AVMAUIATIUHSHHdH%(HD$1HAXH0rnH%rH-s@HHMHLLH$HT$dH3%(uNH[]A\A]A^HH5.H HМH@^uHCXtDAWIHAVMAUATIUHSHHdH%(HD$1כHH@LhHL HHXHL IHL -H ϓ1MHoHL LHK HHLL HT$dH3%(H[]A\A]A^A_fDHLkHupAtfL HHXHL IHtgL -H -E@L1H5\1\DHLLL,$^ @fLI DLJH5)1*f.HH֋QLdH%(HD$1BLAO@OA8MXIMMCXu iAO@OA8uM@MPXt ЍPwHQ+BD$B t 1D$HT$ Ht$dH34%(uHO ff.@AUIATIU(SHdJ HHt,HLkHvLc HHCHH[]A\A]ÐL1H5ęf.AWAVMAUALATI1UHSLHL@ƃMHtHJ31DHI4HHt,LLъ HLƊ H[]A\A]A^A_fH1[]A\A]A^A_ff.@AWIAVE1AUIATIUSHHHYILAƃILDI)HD$, t LT$1A::tIH[]A\A]A^A_IZHIDILLI)HD$+tLT$A::tIZ1uIZH1IغILLHI)`^H]Pf.LAHuL@SH 81HH W I؅xL[L1H5dE1ff.@AWAVAUATIUSHH(H4$H5ɗdH%(H$1 HH H<$L$D HH0HE1} H$IH$H$HD$E>E6IHPAfA9AWՃA:LfEgAL)H<$LHI>H>HHڇ H$LH$"IH$E>EOA L;L9dHl$L f. HmH9HEuHHL=47E1蚈 Lu LmH5"HD$HoHE@HHt$Ht$I9tAt$HPI9uA|suHLW/IIwAHuM1LПH5/H<$H1B H$dH3%(H H([]A\A]A^A_DHDHH襇 HHP !t(#tuH HHH HHH HHLfE1ɀ8:fDHt$H<$H7L$JfMcH27KdHDHEP w/HL$Ht%HA8HH HHHE@L3Hl$I9AA-LD$-D$-?fDAt%I΃A9DBA9DGHmH9HM9uHH HHI- IHtHH IN / (MtIE/ HHEHVfD;D$HmD$H9fDHHl$H9E1E1D\$=A9t E9E)E1 AHH9HPJAAut܃A9E#E1ɃAf.|$9FljD$DHM Ht Hp>ZHHHEH%DD.DtLT$fET$VI1A-L$L H} LHNHEHf.H<$rA IHFHLH5oH L@LI11H5ʐ H<$1= fD$-A-D$-f.Ht$0HfoD$0foL$@foT$PHD$`L3)$)$)D$pH$HDŽ$DŽ$L9G1A1D|$]AD$ AD$HcL$HH)HH4H)H9HHOHiҀQHՐILH9IIFD AD$vAD$у w$f.I~ 1IAAAIIALEpAD$vFAA XA NH WJcH>DHQAHD$@HD$pAD$x-l$D$|D|$A)|A*gD$#-!H|$pfH)|$#HD$ HD$(H$H|$ H$t Hl$ H|$(H$Hl$(Ld$ H<$HH$: 1ILHP H_ vH<$HZ= HHL1H5Z lDH9H wjH HMH HHHMLMLH5; fDDŽ$D$|H HMH HHHMDD$x H|$pD$pH)HD$ H;HD$(jD$D`ك-,AnH|$pH)|$!HD$ HD$(H=HD$ HHB8Dl$xuH*LIHLH?HH)Ћ$)H@H$H)Ƌ$HHcH9~  $)AH HBP @HIiŀ: HIiŀQHD)$LHL)HlDl$tLDl$pIiHLHL1H50HD$(H LHL1H5L1H5HD$pH|$pH)HD$ H/fLHL}1H5`(,LW1H571LT H5Lw 1ɺ1H5L1H5|f.LHL 1H5HLH|$pD$xHD$pXH)HHD$ HD$(A)t{A-HQHL$(H|$pD$xHD$p H)HD$ HD$(AHQHD$(1;|$#uH-HD$ y$$Lct;H'BtHcHiQHDHD$(;AE D$xHcuHdHHHuHHHHtFH<$H*5 DUSH(dH%(HD$1IMHL˅t|t"Ht$dH34%(H([]1HL$HT$LH5uHH4 HtxHT$HHT$HPHLHy1L6H5<H1DfD4L;H5H1Hu;HH wHxHEH ,HDH HHGH8HDH5HHDM HHq`HLH\HH[ff.HHLH87H,ff.HHLHH7Hff.fHHLHX7Hff.HqXHLH[HHff.HqXHLHمH*off.@HqXHH7LH?ff.@HqXHH7LHff.@HqXHLH u7H؏H5L9 HT$dH3%(u/HyHuHAXLHH@HH$臬 SHHHHtHH1˶ [@LYy 1ɺH5_1[ff.fSHHHeHtHH1k [@Lx 1ɺH5d_11[ff.fH1H5 H@HIHtHgHff.SHyXHt)HH^Ht1HH1贵 [DH1H53藵 [ùLZ_ H5^^1[f.SHyPHt)HH^Ht1HH14 [DH1H5 [ùL^ H5^1[f.SHHH-aHtHH1軴 [@LIw 1ɺH5]1[ff.fUHSHHHy dH%(HD$1Ht7蒤HT$HHD$ Ht$dH34%(u+H[]HH5H .ff.SHHH {HtHH1˳ [@LYv 1ɺH5\1[ff.fUHSHHdH%(HD$1HAH@X@uA u:HH5HD Ht$dH34%(u5H[]yHuHAXx^HHHH$ %DUHSHHdH%(HD$1HAH@X@uA u:HCH5CH褲 Ht$dH34%(u5H[]yHuHAXxnHHHH$l DUHSHHdH%(HD$1HAH@X@uA u:HH5H Ht$dH34%(u5H[]yHuHAXxHHHH$̬ DSHHH\Ht@8u#H5<7HH} [fDHH1c [@Ls 1ɺ H5\Z)1[DULSHHtHй7HH1H[]=DHHH[]AWAVMAUIATIUSH8dH%(HD$(1yHtOH\$H2K HLLIG Ht$(dH34%(uH8[]A\A]A^A_f.H=| H| HHHL{PdHHIWxAwpHH%tQIAHHIGHLLk HD$  D$ 9fDLYr 1ɺH5X1L8r 1ɺH5Xp1@1Lr 1ɺH5XG1Lq 1ɺ1H5WXDLq 1ɺH5,Xc/ff.@HЋQtH0HFfDHmH顬 UHSHHdH%(HD$1D$A[u2H/HH` Ht$dH34%(u8H[]fH8WpD$tHT$HH cATHIUHSHWVt HHXHs H|]HtHL1 []A\Lyp 1ɺ H5V[1]A\f.SHHH݁HtHH1苭 [@Llc H5VN1[f.AUI1ATUHHSHHHHtgHI' HHtOHGU1҅u)HULHL H[]A\A]HH@HP`1Lb H5UH1[]A\A]ff.@AUI1ATUHHSHHHHtoHIW HHtWHwTu3HHEHLL H[]A\A]f.HH@H@X1Lau H5TH1[]A\A]ATIUHHSHHdH%(HD$1H$GugH$CZu-Ht@H LH) HL$dH3 %(uJH[]A\HTHH$HuHņLH @HHGH$*f.AUMATIUHHSHHdH%(HD$1fH$Hu=HH5>H蟪 HT$dH3%(u(H[]A\A]HMHLHff.fATIULSHt&LHg7HH߉[]A\VfDHH[]A\ATIULSHt&LH7HH߉[]A\fDHH[]A\QSHHHMHtHH1苩 [@L_H5RN1[f.AVMAUIATIHUHSHH dH%(HD$1HL$HT$_t;IGHT$LL脤 Ht$dH34%(uLH []A\A]A^HEPHNL*_LuH1H5QXZff.@AVMAUIATIHUHSHH dH%(HD$1HL$HT$菨t;IGHT$LL责 Ht$dH34%(uLH []A\A]A^HEPH>L^LuH1H5PXZff.@AUMATIUHHSHH^Ht!HMHL[HH]A\A]雳HH[]A\A]&fDSHHHeHtHH1+ [@Li 1ɺH5$P1[ff.fSHHHcHtHH1˦ [@LYi 1ɺH5O1[ff.fSHHHM\HtHH1k [@Lh 1ɺH5dO11[ff.fAWMAVIAUIHATIUHSH7HtrHLHHt-IGHLLH[]A\A]A^A_: f.LYh 1ɺJH5NH1[]A\A]A^A_L 1EH5N\f.AUMATIUHHSHH`Ht)HMHL[HHH ]A\A]f.HH[]A\A]ff.AUMATIUHHSHH\Ht)HMHL[HHH ]A\A]f.HH[]A\A]^ff.AUMATIUHHSHH~]Ht)HMHL[HHH ]A\A]f.HH[]A\A]ff.AUMATIUHHSHH]Ht)HMHL[HHH ]A\A]:f.HH[]A\A]~ff.AUMATIUHHSHH[Ht)HMHL[HHH ]A\A]f.HH[]A\A]ff.AUMATIUHHSHHWHt!HMHL[HH]A\A]HH[]A\A]fDUHHHSHHdH%(HD$1^Ht0HHHH$螝 H\$dH3%(u&H[]1H5H_ 胾AWAVIAUATEUHSHxdH%(HD$h1HZpLjpI9EL|$ AHL9HCtEt1HH@LHSHH`hHC0HPEH>uD$Ld 1ɺEH5J1UDL$fD0AHL$hdH3 %(DHx[]A\A]A^A_@HHt$蓂AIMLxI9tLT$MwpMtYI~HHHLT$yLT$ELHHI!DLT$GLT$IGxLxI9u(MME1M9uDM?M9IGHxG\tDL$L\$IL\$DL$L9pXt L9uIGHPHzHH8HDL$L\$HT$HT$L\$DL$"EHDL$HL\$I!DTL\$DL$BL+b 1ɺ`H5HcE1!Lb 1ɺ@H5lH9E1D$La 1ɺBfIMI9ELt$ AHL9HCtEtAHH@LDL$DL$HtlHHDL$]HCDL$0HPEHDL$1DL$uLa 1ɺoH5|GIE1L` 1ɺjH5UG"DL$L` 1ɺMH51G1E1L` 1ɺlՉD$L` 1ɺO`D$Lm` 1ɺQIDL$LU` 1ɺ\1LB` 1ɺ^H5FzE18譹ff.fAUIATIHULSHH(dH%(HD$1H4$jHD$HHdEHڅu]DHAAÅtHHGHT$LLq HL$dH3 %(u{H([]A\A]fHHRHt$H<$ L;_ 11H5EqL_ 1ɺ1H5EGs}ff.fAUIATIHULSHH(dH%(HD$1H4$:HD$HH4DHڅu]DH1AAÅtKHGHT$LLD HL$dH3 %(u~H([]A\A]DHHRHt$H<$ L ^ 11H5yDAL] 1ɺ1H5ODpMff.fHHHIGZ f.HIdH%(HD$1HAHt H@Hu31H5AL袚 Ht$dH34%(u"HH@8HLH$} 薶fDHIdH%(HD$1HAHt H@Hu31H5L" Ht$dH34%(u"HH@8HLH$ fDHIdH%(HD$1HAhHt,H@HLH$蹔 Ht$dH34%(u!H@1H5L 裵HIdH%(HD$1HAXHt,H@HLH$I Ht$dH34%(u!H@1H5L 3UHSHHdH%(HD$1HAH@uSu.1H5\H轘 Ht$dH34%(uAH[]ÐHHHH$蓓 ɐHTAHH@H@蒴fAUMATIUHHSHHLHt)HMHL[HHH ]A\A]f.HH[]A\A]ff.AUMATIUHHSHH.SHt!HMHL[HH]A\A]ۣHH[]A\A]ffDAUMATIUHHSHHnOHt!HMHL[HH]A\A]{HH[]A\A]fDAUMATIUHHSHH.PHt!HMHL[HH]A\A]HH[]A\A]fDAUMATIUHHSHHNPHt!HMHL[HH]A\A]黢HH[]A\A]FfDAUMATIUHHSHHNHt!HMHL[HH]A\A][HH[]A\A]fDUHSHH(dH%(HD$1HAH@H)raH*s:(HHL$HH HD$KHT$dH3%(u]H([]@H)nH5)H芕 HLD$H4$HxG>LD$H4$HH@H@myfUHSHH(dH%(HD$1HAH@H)raH*s:,HHL$HH HD${HT$dH3%(u]H([]@HYmH5YH躔 HLD$H4$Hxw=LD$H4$HH@H@m詰fUHHHSHHdH%(HD$15PHt0HHHH$> H\$dH3%(u&H[]1H5H #UISHHEAt$ D\$(Eɋl$0Dȃt$8DEDȃED\$@DEDȃDEDȃt$PDDDȃ EDEDȃ@DEȋuk%H 6HEL/v6H5w6LDH6H56HEWLQHt$XRL蝟 H HHtu%HH[]1LWq6H56fDH5<H HH[]ff.@HHH EAH56WL&HVH5N6RHv6Q H(ff.@uFu^H6@ǀt 6u+H uHHH1f.H6HHHH@HDHy6AVfAUIATUHSLH@dH%(H$81H$H,$Lt$`)D$@)D$0HD$PLt$HLD$ILL$LEH|$`HH$xHD$H$pHD$ HHT$(Ht/HKCugH;CHtfDMI<$IL$H1, H$8dH3%(H@[]A\A]A^DH7HH$HHC`H7uDMt6L#@HD$(H9HC`Ht H@0HD$@HC@HtjHD$HHD$0HD$( fDHLe DH<Hi7H$HC`Hr7DBfDo oS$A} ff.fUHSH 6H@HHHɭ t ;uH[]@USHhdH%(HD$X1M7H$L$L$Ht$h$HLDMɉ-f7LDHHT$HDMHL$LDMLD$ LDЋ$LL$(H\$0D$H$L\$8D$LLT$@HtH HT$XdH3%(uHh[]fDҍ7ÐAWAVAUATUSHhHt$T$H|$H|$ dH%(HD$X1趿|$,Ll$8Ld$0L|$HLt$@蒥|$(HfHHMT$MRHSHt$0VAWAVHt$8H|$PwH0HL$XdH3 %(uHh[]A\A]A^A_f.DHGHWpA AHp0HGH@PH8rfHGHIHWpHp0HGH@PH8f.SHH0oH[ffDAUHATUHLSHdH%(HD$1HLd$@Ll$H H$Pt2EHL$dH3 %(H[]A\A]DukHI$HpIuIu@HtH;PtyH9Pu[EDL'O 1ɺuH5Yh1]rEYI<$J EMIH"H5 HCRŅ!1H5 HMHID$H/HxPL1IID$MBHxPH1HL$ELHL;o/fLf1/H5f HL$dH3 %(H[]A\A]A^A_DID$HL`HQHLhATIB1H5e袮XZfDADID$HL`HwQHLfIATEHhHHLQHLfIUHfDHhHHQMLgULPID$HHhHPHLoeIU5ID$HL`HPILgATPPID$HHhHPHLeIU>Y謤ff.FuG3u*8f.H=dSHHt [Lg1H5c[ff.AUIATIUHSH(dH%(HD$1dÅt&x?<tDj?<Ht [?<EHL$dH3 %(7H([]A\A]HL$ LL$LLD$H5?<3u><1H52cLt><|$ vJ><><HtEMMAD$3A><tOy><,@uD$ w tXLe1ɺ1H5ibof.1H5[bLO><É ><|$CffDATI1H5~ UHSWTLnUHEXH5gLHPH1MUÅHEpHPHE3t-H5 bL1$UÅ[]A\fDH5aL1TÅuL*H 1ɺ]1H5Za`fDLG 11ɺYH5/a5[]A\fD1LG 1ɺZH5a[]A\LG 1ɺ_1H5`ߩ5f.HGHWpA E1Hp0HGH@PH8DUHHSH脡HHtlH7HHCHHC HHC(QHC0HtHKLK(Lu 11H5`HH[]ÐLF 1ɺ1H5_f.LHctHGH@(fDךHH=Ncff.fATUSA@LLHl$ Ht$(It/AP8HDCLHHL[1]A\{IxHGPLOHHLzvuLE 1ɺH57bק1DI@LbH5bLHH1褧[1]A\DLAE 1ɺH5ay[1]A\fAUIATIUSHHdH%(HD$1LtHW8H52LFŅHH57 LHŅtFCP1E1LLHsLH$CP~HL$dH3 %(H[]A\A]HCLHXHIHLaSIV1H5`茦XZHCLHXHpIHLhaISP萝ATUHSDOLA1L`1ɺ+H5v`HEH@PH8DM8L`113H5>`A֥EL1L%l`t?fDAM1ɺ6H5`1蠥HH k9]Lw[L]1ɺ:H5_1A\bfu8L_1ɺ0IH5_14YHj1jSHót7<t 7<[D1HH5_7<͸u 7<[Ð1H5H诸DGL;FLN89O8ATUSLA8uqLA9udIIIPD_PHYH9ZuNLT@I0DI9t>A<u*A<u#ILITHHYH9Zu ZD;Yt[1]A\1IHHHxtAD$$E$1AD$PEPELuDD;]Ls7HH@HHƒ:uI$HzHtA;]Lr[]A\UHH5;HSHBt H[]fH&FL^AIH5f]1H[]fDUHH5]SHHHOLHHE{Kt?{Lvs81HHHHtFHHH[H<]]yfDL!@ 1ɺcH5\YH1[]L? 1ɺgH5\1ff.@ATIUHHSHHtGHȋ7HM1HC L~n 1H51\Lc(HkġH[]A\@La? 1ɺ1H5[藡DHH=VfDHH= \6fDHD11L\H5\L11H5\Hff.SHH0H[fDAWHMAVIAUILATUSH(HT$Hl$`Ld$hdH%(HD$1 HD$@t@AEHHEHL$dH3 %(#H([]A\A]A^A_MI$1ҋHTIGHHDHHHHD$H8H9wGH AEHD$I$mDLo= 1ɺrH5[1襟LLH5LHD$HD$H0 IIHT$1IL\1RH5#[~AVHHD$ HHXZOfDAEHPI$VfDAWAVAUATUHSHH5ZHH(dH%(HD$1Ld$L?iHEHt$HxP IHkHH5= H>ADžH5 H AE1H5H@ LH5H?AHEE/HxPHt$Y HD$HHH5'; H=ADž"H5Hk@SLH5H>AHEEyHxPHt$IHHEHHhH@L]UPLL$ Rf.AHEHHhHM@HLZUIH5X1!_AXHL$dH3 %(DH([]A\A]A^A_HEHHhH?HLZIUDLH5 H~=AHEEHxPHt$IHHEHHhHt?LZUPLL$ Bf.HD$'fHEHHhH0?LYUPLL$ H5W1E1Y^HEHE1L`H>DATLK[H5WP1跛XZHhHH>HLYIURfDE1LD$1LLHADžLHrdADžA@HhHH,>HLZIUfDHhHH=HLYIUfDHEHHhH=HLYIUvf.LI8 1ɺ1H5XV\f.L8 1ɺ1H5(VO,HEHHhH:=L1YUPLL$ XHGHWA E1Hp0HBPH8fHGHWA AHp0HBPH8fDHGIHWHHxPHr0HH? ff.AVHMAUILATUSHdH%(HD$1HLd$@Hl$H tnH$@8uTMHpHx9~ AEH$HPI$H@HEHL$dH3 %(uvH[]A\A]A^fAEАLw6 1ɺH5T1識Hp Hx} AEH$HPI$H@ HEx贏@SHGHwTH@PH81Lgk +IH5 T11z1LT,IH5S1HCH2 1LS.AH5S1ΗL11LS/H5zS覗HkL 0 LEȺ111LSH5ESlL113H5$S[Jf.ATIH^ULHSit'H^LHiÅtg[]A\L?W1H5RҖ1Ly4 1ɺH5R豖[]A\f.1LWH5UR|[]A\DAWAVAUIATIUSH(D Q)<dH%(HD$1EMt1)< )<t7!AE)<H|$dH3<%(&H([]A\A]A^A_1ҾL!aH8L` H-e6L=r2 Mu&@Mt$A>Md$MA<$tL \1ɺ1L%VH5EQlf.HL$ LL$C(<LD$H5\F((< H6L5\HfD9D$ w u(D$9CwC '<HH9DHsLl 1ɿM1H5P譔_AXH-16'< '<Hv6L%[Љr'<HH91o_AXHT$H5 H!ÅID$HL`H1%HLGIATHT$H5P H!Å|$A$ID$HHXID$HHhH$HLHUII1H5l=蓁XZ9ID$HL`H{$HLcFIATzaID$HHhHK$CLRGUPLL$@ID$HL`H $HLFIATH5>tvH1[]A\A]A^A_HH1-tFHcȃHVu t\1L&>H5N>v1HÐ1L=H5">u1HDHfH1@-tHcȃHVu t 1f1IfUH(SHy HHtI(HH!t HH[]L 1ɺ1H5U=uDL 1H5*=tfF$G$FPGPf.fHt$H|$魨ff.fSHHGGt [L=1AH5<Bt[ff.SHt1<t #<[DHߺH5<[<fSHkHHtDHm_7L 1ɺcHC L>@ H5N<1LK(HCasH[L) 1ɺ]1H5<_sf.AWIAVEAUMATIUSHHT$JHT$HHHtHHIMt A<$MtAuHKEus^L$hT$X>D$`jt(HN MtLH=DHH[]A\A]A^A_T$PDH蜯qL 1ɺ}H5;%r@LHL 1ɺwH5:q fHx Ly 1ɺH5:q@HJL|<H5e:vqHILq<1ɺH50:Aq@H0ILa<1ɺH59 qb@L 1ɺtH59pH1@\Ly 1ɺzH59pLQ 1ɺH5x9pL) 1ɺH5P9ap|@L 1ɺq1H5+97pfAWHAVAUMATIUH1SHhHt$ dH%(H\$X1HjHE1RAQ$ RD$1~H HHMHD$ DEdH틌$…tEMHD$ DEI|$Hwo HOHFP1HAO$AA)LHHHD$HFXH'"HD$H @fHL$8HT$Ld$1L|$PLt$HHT$(ILl$@@HD$PHtZMMLLHH?H9l$8uHT$@H;T$t0HL$HIHIA[@t H;T$Ht$HtH9uHl$HLd$HMl$Lt$PIEM}AD$ @[MIE@Y@II(HEe5IG H@@Ht HЅID$HxUI1ɺPLS9Aw(H561m^_LC 1ɺG1H5m6tmH|=H\$XdH3%(Hh[]A\A]A^A_HآHt#HLxdtHD$ p@HD$EtkqHD$ DEYHHW?MLx 1ɺ!1H55l5fH;T$(3@HHD$GL+AG( fH*H=a#H€H=#H€H@PH5\H8a&IHL 1ɺ1H54k%IG \H*H$H%|AD$@HT$VfI|$HT$HD$HGH@X9f.L 1ɺ1H531jHD$I<$IT$Lq AD$BI<$IT$L赆 AD$I<$IT$L詁 AD$ID$HxHMO(1PL5I<$IT$L  AD$I<$IT$L 0AD$hL 1ɺH52iIuI<$MD$LHL$ ~eAD$L, 1ɺH5S2diI<$IT$L AD$L 1ɺH52iuL 1ɺH51hQI<$IT$Lj AD$KLh 1ɺH51hLD 1ɺH5k1|h_L 1ɺH5B1ShL 1ɺH51/hf.AWIAVIHAUATIULSIHHH$0H$HHL$8DD$dL$8HT$@HD$hdH%(H$1MHDŽ$HDŽ$D$|HDŽ$HDŽ$HD!HD$0HNDL$d E;LE1MLH$jjjjH IH1D$EMt $AEH$D$`E1HD$ H$HD$H$HD$H$HD$HD$|HD$HH$HD$PH$HD$(HD$XD$`MELL$ LD$LLHL$HT$f7IHt HH_ HHHD$(L$MtH$tHt$8LY]HT$0HJ t#HA@HqLЅdHT$0HJ HAPHNt$PI|$IL$I$t$`L$LD$8Ht$X_AXWt$`T$|HD$@u t uaHt$@MHtkHH< HtWHL0IH5-1dE1$$I Ht$@@L$`HD$@$@I|$L-IH5Z-1ddALDL$a4DL$D$duTH$dH3%(DH[]A\A]A^A_ 0ef.DL$DL$tHD$hL| 1ɺH5,1cE1`@H(~L/IL! 1ɺ1H5K,DL$RcDL$1ɺD$L H5 ,cDL$L 1ɺ~H5+bE1L 1ɺ1H5+bE1tLi 1ɺ1H5+bE19LBYff.USHxdH%(HD$h1uHu2ǃHL$hdH3 %(Hx[]1Ҿ4&uHl$PHpu<1L.1ɺH5*aǃ|1HL$HT$HLD$ H5 Tu|$tv8|$w{Xf.AUI0ATIUHSHH?谕 L-HHL HEXH%sMHHkHCHCHC(HLH5_H[]A\A]H0siHHHCHCHHCH HC(fHZHvHHCmfDL- 1H5)$`H1[]A\A]AWAVAUATUHSHLb4$H$LdH%(H$1D$HߋuLID$P1L01HLAH$8HEH8AD$^LIHLo(M11t H5/(;_DEE11L"SBHL$P@ljD$HHL$mO1DT$HL$H?H<AbHHuDAjM=U8RA}MH 9tH{;HDHLsP PH$H5R'P1R Z^H A:@u1L{)HrH@ H 8u,HHH@H HH8tLM( L+H5&1]E1H$dH3%(DH[]A\A]A^A_H&LIHLwj LT*Iz@HcHT$1LLHA…X|$ZDmEu H} E$D} 1Hl$ Ht$0DT$D$H$H$0HD$@HHD$0H%HD$81HHL诛DT$HH¾HDT$NHt.1HL$HT$HLD$H5 ODT$HH5(%I1t$8K 1L +\^_HL$L+1ɺ H5$1[AcR8OA}H gqH8HDHMPH6 LM PRx H5v$1[H E1@DJD$H-pH68Q8I'OA}HMHEHLM PH H5#P1R} ZH D$DIA…A<$NA}MLL HDH PH^PSD;|$r D$;D$ HDT$EPDT$HtDT$H1ɺI D$L(H5+#PHo#AWAUP1SLL$`'ZH0HDT$ $D$\$LtH LK)SI1H5"YXZD$@Ll' H5"YE1fDL$ L'Lsp L&IwLsL(1ɺ IH5"1%YD$XM 1Lt&H5!XALL$0LD 1ɺ; H5!XL$L'1ɺ D;l$  HNNHtH1ɺI D$L 'H5>!PH!AWAUP1SLL$`:XH0HdO@HHAE11dH%(HD$81Hj1jjVHH Ht:H'$uHT$8dH3%(u>HHfDT$1LQ 1ɺH5x W1N;t@HH?1Ht;H5a |JtY;HD E;A~H1-jL&H5VX1= ;ZfAWEL 'AVIAUATAUSHH$L$L$H|$0H$H\$ Ll$(dH%(H$1EILEH5MLd$R@SVMLH$HLjAWDL$,H U-L IIHtxHLB7Ld$0bDI}7MuLELL3b HHLjjAWDL$,LD$0HL$@HT$8zH Eu!HH3HuH|$(HǠufAHL$xdH3 %(DHĈ[]A\A]A^A_D$ L 1ɺEH51UDL$ @HI~HjjAWDL$,LD$0HL$@HT$8H dD$ L 1ɺafD1ɺTD$ LY H5TDL$ #Kff.AWMAVEAUIATIUHSH8dH%(HD$(1LT$pL\$xD$$H:HӸHt8t4HD$$MELP$1HLPASARH 1L 1ɺH5S1HL$(dH3 %(H8[]A\A]A^A_@HD$$1HD$P$PASL\$(ARLT$(XH LT$L\$uVL$$pID$L\$LT$HLT$L\$u1T$$fD?fDt$$M1HSELLPASL\$(ARLT$(H uD$$LT$L\$If.SHtHSXH%r[ÐsHa[HÐSHGPH1HWHHHHxY HtHH[^fD1L 1ɺH5R1[AWIAVEAUAATEUHS1HH?HT$dAG\ ueEtP LeڃHEEڋu؀EE؉؃ EEH[]A\A]A^A_H|$t LHHu@LPtIGXH%rɩ@uIH!ڃ EUfAWAVAUAATIUHSHHDO,Ht$dH%(H$1HrB HDE]HGLGHHLHUPfHDŽ$)D$`oJhoRx)D$p)L$@)T$PEH8HoHH5# L)\$`obHT$@)d$pY IHHEPIVHHI<$HoW HHI|$E1E1jHjHT$(RLH AƅDD$EudAH$dH3 %(DHĘ[]A\A]A^A_fH@IF HHDfL?I|$E1E11HH8T$,t$(H|$dAƅAL$,WHiAUIٹPLy1 H5NIt$XLZLHƸG!AƅL^ 1ɺ" 1H5NL1 1ɺ 1H5[E1dN1ɺ E1L H5%6NL 1ɺ 1H5N\f.HH5D$4L@ PDL$81M^_EfSLZIHBIS H@PLR8MtEIHG1ACt APLA+SAP(HHOPA@$)HPVHWH7AH [L0LJ IH51)M1[DAUIHATIUHLSH蒾HtMHHHSHt2HOHHtRtHL} HH[]A\A]1@LY 1ɺ1H51LLgLi1ɺIH5R1\Lf.ATIUHSHHt uAHMXH"r6H!r/Ht:AT$uH[]H A\Hf1[]A\fH%r@tf.AWE1I1AVAUATUSHHHW8 t$lH$IIdH%(H$1HAHDŽ$H %j j1jPHD$HH H]D$Eu@E1H|$(#H$dH3%(DH[]A\A]A^A_Lt$(LsLHD$pցHŋD$lD$jtD$ED$lD$k Ht D$l0S H$D$DE1HD$XH$HD$PH$HD$HH$HD$`L|$8LL$XLD$PLHL$HHT$`H|$('IH$HD$jt)L=iHLAAEE  HH='AA|$kE+EtHH=€HD$8E111HDŽ$ HP8jjHIjH I%A 1PHD$0H H H$11HD$ H$L$HD$H$L$HD$H$L$HD$0LL$LD$HLHT$ H|$HH$H HH=€uZH$HILL$01LLL$H5;H@\@HƹH=D uNH$H1LH5{ L;u$$u1HH|$H$ H=HAAEEHH==€`H=HAAEET$DtDH$H=< Ht"H=HD$DML|$8D$lt D$DAf.$$}V$$b;1H= H$u HHL$HHL[ ]H$HXv S H$H=H$u HHL$HHL\ H$Hp8Ht#H=rAAEE)Hyu H$@H==HDŽ$t HHHD$8E111 HP8jjHIjH I%A 1PH HH]H$H1L$L$HHD$H$MLD$ HL$H$Ht'1H$H$H5 7zL|$8H1ɿL+H5F IW8HIH I%A кP1,DAXHAY0Ht H$LZt$pL SIH5 1CY^fD蓦5 H=" L$H$H$HDŽ$r HD$H H|$H$Lj SH$1E1Lt$8z^fDDHrH@H8AtDLYHATI1LHH5 BXZH$AD;brHD$8E111 HP8jjHIjH I%A 1PL9 1ɺ1H5cL|$8j>Hbn EDL|$8I_8LUL1H5!HIHH  1RZS>AZHA[m H$LTt$pLyISD$E#LoTHLt$xIH5v1=AXAYWL 1ɺ1H5JV=fDH|$Fm H$ffH= HAAEE9H'/HE\Ht$pH$0H$.I 11H$H$L$e? H$Ht 苭L$(A<$D$l  H=Ht8 H=HtH=H}CHRHDLHEE1RHt$xI1L SH5U;H LLl$x H|$k H$L) 1ɺH5Pa;@L 1ɺ|H5(L|$84;LQHL It$xxL|$8L 1ɺH51:H|$j fD1ɺE1Lj H5:fL|$8LSQL1ɺ,IH5e1o:Hw fL 1ɺ$1H5&L|$8-:L 1ɺ(H5L|$8:H Hi LPHL It$xD$l 8HHD@1H$ HHB= H111BHHH$HP0BRHH H H%H HC81H߃4 @RH|$L|$8h H|$L|$8H$LOt$pLfIS&L|$8H$LdOt$pL ISL|$8L9OL IH5H1R80L|$8L 1ɺ@L 1ɺ1H5L|$88LH|$g LNHL It$xAt$IF@4IVHt$H;1iHtdIVBHtOI~GHIGHLAVI 1H5" .-XZAD$HEPHUH1H;Hw4 IHC E\  Hr?HH$.E1I9l$(ImH{AAL$H$HEMED$ AT$E1LDHEPHDT$H@`% H H$AD\$H<$D\$ADT$E11HLLARAUASH|$89HD$XH HH|$86'IEHEXCH2sC,H-fHvnH<$H{LHHD$0L9H $HKAH-D$Hl$HHl$HHDHEHT$ HD$(fDI}gIHMDM~IG H@H LLHD$I}EHLjt$0 H5 t$0P1LL$(*IG H H@XHtIVLHJP1H9Ѕ MMtD[(EgC(L5ELYh IH5t 1~*L薿LLHIH* MIL9Ll$MIfDMmM9IEL;uHx-IUH;HHHRHtIEHxLHHIIEHPuLq 1ɺz H5 ) @Ht$H;1HnH%HEXH-H RHEXH0H;H@^fH"HLHL}PHD$HH HD$AL$E1HH0ED$ H{H$HD$(LT$fD$ IB@^U LT$MNHH1uH1! L H5{ (ZLY袽Ht$LLIHLT$I8fIN H;H$)$H5 H)B0)$0HD)$)$)$ HDŽ$@AoOhAoGxHB@)$)$o)$oXI@)$H)$HD)$H o )$ oh)$0?1 HD$H H;H$H  H5 1 HD$0HIVHIH D H;. HD$8HZIVHIH  H;s. IHCH;L1zIHD$ AT$LHD$ HEPH@`% HH H$ɉL$HTHAAD$(PAUL$`QHT$(DHt$XH|$84H IHC,6HLT$@H5% IL 1H %<$Ht$LYnHEPAT$1LHH@`% H H$L$HALAD$(PAUL$ QHT$PDH|$8@3H IHjC,iH@H5f ILR 1e f%Ht$(L Y}L 1ɺg H5! 2%fE1L=:MHHt$E1LHHHP:Aƅ HǨHt$E1LHH AƅRL[ 1ɺ 1H5 $2@HpH@HH<$HEXH% @ L$LHHL$0L9^D@qHt$8HHmAƅRL 1ɺ1H5 #b@La 1ɺ H5 1E1#5Ll$L >Lg } IH5J 1T#C(IHtE1LHH(IHtE1LHH[SIHET$EIhAULE1[IEH@tcu\IHtPJT0HtFIHJD0H@XHtt"E1LHHfAE;}LDL4@IIL8dHPHHJXHt Ds,tIEH@ 4E1@uYLHH# Lt 1ɺ 1H5 !f.LI 1ɺDH蠶IIJT0K,I}; L{ IH5# 1-!IEIUH@P1Bt AEL+BAE(Au$H|$8)HT3AE8AELt$Mm9CƉD$L;l$0VH<$Hl$HHEXH%sHt$8HHKAƅ HEXH0 HUHH=OHuz_HHuhL|$H;1HLHtNLHL@LHLHAƅu.L 1ɺ51H5 t$X1҃H|$8C0tPEY tJLHL9t7Lt$IEE1LLHHPwMmI9uD$DC,@IG(HD$fkLHHIIIhHt3EL$E:,LHHIhIDdIHED$ELHHIILR 1ɺ H5y DHt$8LLHzL 1ɺ H55 FI}8HL t$I1 H5 []aL 1ɺ H5 <@L 1ɺ 1H5 XfLY 1ɺ H5 @HE1 8HL t$I1 H5B NAXAYDDExMt@Lٺ 1ɺl H5 L 1ɺ 1H5 KHРHHH@La 1ɺ H5 @1ɺ E1L* H5] nfH<$Ht$LHHLmNAƅ! H(IH HpXH;H 虍IH IupH;HNzHH IEXAu$H@PDAD$LuHHL$HL$ EMTH|$8LLAN fHEXD$C,@L 1ɺ H5( 9@HBHt$LHIH\AƅHt$8HHqAƅfL 1ɺ 1H5 fHEXL` 1ɺ0 H5 cL9 1ɺ H5` q@HPH@^u>H<$H0H$Ht$H;1HH[ HEXH0HH@^t&H<$Ht$8HH膸AƅHEXAft$t$XHt$XH$;t$X$L1 1ɺ H5X i@L 1ɺ 1H53 ?f.Ht$LHHL! fAƅlAD$^E[THFHHt$LHHPpLJAƅ HIE[+ H H;H HIH IvpH;HJIH IvpH;1ډIH ENTH|$8LLHK LLM9Lt$IWE1LLH:{M?M9uUDLL $ H5 yfH;H HH]HH|$8HINL 1ɺ H59 JL 1ɺ Lٴ 1ɺ1H5 1ɺFAL H5 A1HHD$pHD$xD$HD$\HHD$ 9HD$HH$E1E11HD$(Hƿ jjjjHL$(H IHL$$tZLJjE1E1j1ҿ jjHL$(Ht$HƢH IH@$$1LHL$hLT$(HT$`LL$xLD$pHt$pLT$(H9H=\aH|$xH1HT$\LT$(H5 LT$(T$\9T$HLT$8H*H  HDȉT$0HL$(/L$D$L & L! H5 QHL$0EQT$@R$PH LD1H LT$8LHt$H|$ E D$;D$\~I~:/I~I./HL AWI H5b 1qAYAZHIVpH;1H W HKuqH*HHEXHEPLMHLLT$Ht$HLlLT$11LLaLq 1ɺV H5 tH,. L IH5k 1uAD$G1ɺ AL H54 EL 1ɺ2 H5 !D$YL 1ɺ1H5 L 1ɺ1H5 iLl 1ɺ5 H5 oLH 1ɺ 1H5r ~H- L8 IHpH2HZHfFHEPLMHLHt$(HLzyHL$1LL_L 1ɺs H5 L] 1ɺ7 1H5 ^I~,HI ,HL IAV L 1ɺ: 1H5. :IFH@NLѮ 1ɺ H5 L 1ɺ*1H5 L 1ɺR H5 Ht$8HHZAƅLH 1ɺ$1H5r ~LT$(L 1ɺH5I 1SLT$(qH*LU ) IH5 1Lí 1ɺ]L 1ɺH5 IFH@L 1ɺE 1H5 LT$(LY 1ɺ7LF 1ɺJ H5m ~IL" 1ɺo H5I Z%LT$(L 1ɺ L 1ɺ. 1H5 LT$(L 1ɺL 1ɺ 1H5 H|$8L|BDLm 1ɺ8 1H5 LG 1ɺ< 1H5q }^H)LT  IH5? 1IL 1ɺ L߫ 1ɺb 1H5 L 1ɺ 1H5  L 1 H5 1 Lo 1ɺ1H5  LD 1ɺ 1H5n z ,L 1ɺ 1H5H T L 1ɺ H5 0 LԪ 1ɺ 1H5  DAWAVAUATUSHH $HH|$ LIMHt$H$HL$(dH%(H$1[TDHHH 1O HHH HD$PH-o HD$H$HD$@%MwHLAAEEtVHIHuAH@H$dH3%(DH[]A\A]A^A_@A$DT$ D$H&THHD$8HD$0?1I H$uH $DEDT$ D$E111jjjPDL$hHt$8 H D$HIEDL$PEL@8 L % 1PH^_ Lf PH5 1 XZ@MLV 1EMyH5 L\ 1ɺ1H5  uD1E1L H5U a T@HDT$L[ALI?L$lT$hLH$L$HT$ $4$L$PL IH5 1QT$RAW H HT$0LH|$8hHT$0IuPLLDIIWH3FhH3VpH vIGIWH3FxH3H ZH|$LDT$LH?LL|$@ADT$ L I}PLDT$ HI|HD$D$PLDT$ #LH$#HH5 HT$I1L3 RY^DT$ H|$(D$PHL$(Ht$E1LH|$ D$iM1EֺL= H5p |L8L$IH H.HDHE1PHg\ L PH5 1R H L 1ɺ1H5 E%L D$IIEPHML ELL$H5x 1_LAXHt$H|$ 1LcD$M1EֺL yfAWAVAUIATIUSHHHRHH?H4$dH%(HD$x1ID$PHZ HHND[,EH;LLSxIHHH{HE1jE1HjLt$(AV讯H Ņl$M#u?HL$xdH3 %(LHĈ[]A\A]A^A_fHCHGbH{E1E11LLT$,t$(H<$Ņk|$s,AD$Y iIl$H_HHNH=D5H0H4$MNMF1LHŅ L% 1ɺ 1H5O [fDAT$tAL$x<Ht$@HE1E1Q11R1jޔH tDT$@El$|L 1ɺ1H5 1VLi 1ɺ1H5 0f.L9 1ɺ1H5c of.LHL AWI H5 1+HCZLYHGHGŅD$@l$,9\$(LL$ $aU1SL$I1L H5 QT$RH )H D$4L PDL$8H5T 1^AXAYDL 1ɺ 1H5# /AD$xHEL$tLe PCAWAVAUAATIUHSHHXdH%(HD$H1HBX t 0H-H0E<1LHHdH LHHGH 4LHH*ID$XH%j@H0EDS Eu C,aL藾t6M$M$M9t!IW1HHM?M9uߋS +AD$[I$L蟿HHHP$L) 1ɺ DH g LHH#AD$\*C C(A$M$M$C(M9uM6M9IFL9uHPHHuω$Le 1ɺr -fE{0%D{,EM$I$HD$L9bIHt Ds(E IHt1HH0dIHt1HH-IhHt-IG@t#D[ HHEAE6IHt-IG@ t#DS HHEAEIHt7HBXH-r H4cs H߅HAEZbEOLE1EuT IGH@t3u,IHt JTHt1HH 'AE9wLDL @IILȃ8uHPHtK,tHID$XsHJXHHL $HL $M$L3 1ɺ H5_ 1iD$Ht$HdH34%(D^HX[]A\A]A^A_DC Et!IWhHtHHM?L;|$AI$st dID$XH0L賁LMAF^1LHH般t8LHHqt!L蕒LHHH4L 1ɺO fHH0$LΚ 1ɺ f{(M$M$M9uffDM6M9TIFHPB^tC,DHH)C,LI 1ɺX H5u 1E1L_1HHHHPWL71HHH3+$Lљ 1ɺD L-LHHH$L 1ɺ_ bfDLLHHHcDS EbID$X@cL貐LHHHQgID$X8AD$Y M$M$C0M9t6IGHxIGu-HP1HHM?M9uC0qHxEHɉ$L 1ɺS ^$L 1ɺ H$Lj 1ɺ[ 2LD$H;LH$lHsHHHhLHHR$L 1ɺ LD$\H;LHkHHH*IHdEC$f)D$)D$ )D$0D$D$-L}HSp L}HL$LHH$L> 1ɺ f$L& 1ɺ $L 1ɺB $L 1ɺ| $L 1ɺ $LΖ 1ɺ $L 1ɺ C($L 1ɺ ^$L 1ɺ H$Lj 1ɺ 2$LT 1ɺ $L> 1ɺ LHH$$L 1ɺ L 1ɺ H5& 7D$$Lԕ 1ɺ L 1ɺ H5 D$+ff.AWAVIHAUIATAUSHHdH%(HD$x1;E]H G H PH! L EH5e HDDH IRL Ⱥ1Z]A_C] tHm 1AAF(AmAF AD$AF$IH!H5J6HbHzHLL11L^HHJMHEU1E<I>HhHD$HAsAAYEMLd$XHD$XEHED$HD$HD$pHD$HD$hHD$HD$`HD$ 1HLIHLHHtLIHtLD$HL$HHT$ I>mHD$p8tHD$HtLHtIFLHG?) HVIVHGHGHDL 1ɺH5 %LΒ 1ɺ1H5 E1L@AiXAHt$$HHD$XI~EHD$pD$Ld$XHD$HD$`Ll$hHD$1HLHHLD$I>LHT$H Ht$`>tHD$p8uI~HT$hH@H두HSXH$H%DfHA~uHHt$$H~ AHDT$JDT$LDT$:DT$H\$xdH3%(DHĈ[]A\A]A^A_@HpHHȯAuL+ LDLHLLY9Ht$$H/H/H`0HCXAHt$$HIHD$@I~HL$@D$HL$HD$XHD$ HD$PHD$(HD$HHD$0HD$pHD$8H|$1HYIHLeIHtL5Ht)Ml$MtA}tLHHD$?I<$>I<$rAT$e0FpD$cH߉D$, L@ IH5k 1uDT$Li 1H58 DE1@L܎ 11 H5 LL 1ɺ1H5 E1afDHh L  IH5 1LQ 1ɺH5x E1AME1WHCXH%r @AHsI1D$IFHGf j ]EFHI~HGHǸGH9L-f IFHHGH9LK1MH5 LcLLHHuL( 1ɺH5O `6DD$EH L 1ɺIH5 1cfD$L 1ɺ!H5 1DT$1D$L 1ɺ@D$Lm 1ɺ,@HYHIٹL H5_ kAfDfDD$L 1ɺ03Hy^AFPL\ H5ݶ LD$ HL$(LHT$0I>LL$LD$8I>LHL$hHT$`LL$cLL$L qH5c tHL 1ɺBI%D$L 1ɺ?Ab IFHG AoD$]HL$PHT$HLI<$A6CA.ML$L mH5 ;ff.@AWAVIAUATUSHHH|$HHt$dH%(HD$x1HD$0HD$8qI>HH]HHt$@jE1E1jH1ҿ jjxH HHDL$@EHD$1L|$8Lt$0LHD$(HD$HD$ MH$Kf.H|$0t0HT$8Ht&H@H@ H@HHtHL$LH9ЅHHHL$H$HMMHuLLHwb IHuH|$L, IH5 1E1HD $D $HL$xdH3 %(DHĈ[]A\A]A^A_fLLa AHtH|$P(L IvLI 1ɺH5p E1nfD $L 1ɺ H5A 1KD $'f$L 1ɺ"DLч 1ɺ1H5 E1:f.AVI@AUAATIH=t US  HtM@HH5 HHt]L`A$H(Lp8Dh0H@DH[]A\A]A^DL! 1ɺ>1H5K 1UL 1ɺA1H5# /H' DH? @AVIAUE1ATUHSHF[tE1HAHۦuHCPHSH1H}HIHtuH}1H'ZHHE1E1HAUH 3LHjAVH Å[]A\A]A^H萦Hq11LՅ 1ɺH5  []A\A]A^f1L 1ɺH5Ӱ []A\A]A^@1Lw 1ɺH5 []A\A]A^@AWMAVAUATUHHSHH(T$ HL$dkHH@L`(|HSHH}IHCPLHL 1ɺHH}LHIXHHD$HM1AUL` H5֯ ILL$HAWt$(L\$8DD$,L7H ÅtEH([]A\A]A^A_L9 1ɺH5e 11mL 1ɺ1H5; GDAWAVIAUIATIHUHSHxdH%(HD$h1HD$HD$ {I<$ AEH_ IHI<$HHTWHHt$0jE1E1jH1ҿ jjIrH IH\$0A]u-L腵HL$hdH3 %(Hx[]A\A]A^A_HL IH5 1!HL$1LHT$LL$ LD$HD$H5H= H€t:H1PL 1Ly H5 XZ$Ht$ I<$HT$(ÅII$HHD$(HpHxHCCfDL 1ɺ1H5# /f.LɁ 1ɺ1H5 f.L 1ɺ1H5ì 1SH[@LY 1ɺ1H5  DATIHUHSHxC\UH=# HtH= HI<$HHTHkjE1E1Hj11jjoH IHlHH衹ÅL/ÅuL踲[]A\ÐH=<"H€^H= H€?H=w, H€ H=G!H€IL8 "fDHL߾ I11H5˪ []A\Ly 1ɺ1H5 f.1LG 1ɺH5s []A\11L 1ɺ H5A M[]A\fDL~ 1ɺ1H5 jf.ATIUHHSHvC[H}HHnRHjE1E1Hj11jjfmH HHtzLHoÅHÅH膰[]A\H1L %IH5- 17[]A\L} 1ɺ-1H5 1 L} 1ɺ01H5ۨ df1L} 1ɺ*H5 []A\LY} 1ɺ31H5  f.AWAVIAUIHATIUHSHxdH%(HD$h1HD$HD$ RtI}HHPHHt$0jE1E1jH1ҿ jjkH IH\$0A$u4LHL$hdH3 %(WHx[]A\A]A^A_H0L$ TIH5o 1yHL$1LHT$LL$ LD$kHD$H-H=Oe H@@@tHսH\LHHctH*?L11L{ H5w 襉(*#HLATL DLL 1H5v 5PLLB 1H5{v  HLATL DLL* 1۹ H5#v 譈LL" 1۹H5u uff.ATIUHSH29t []A\fDHEHM $L pHH5vu 1XZ[]A\f.ATIUHSH>t21Lwv 1ɺ H5*u 贇[]A\DHEHM $L pHH5t 1sXZ[]A\f.ATIUHSH2yt []A\fDHEHM $LV pHH5vt 1XZ[]A\f.ATIUHS~1fDI$H[]A\fDDHH[]A\fDb;tӋT;H{H?g t&:;t,;tH{H&g [H]A\D1LGc H5` ds[1]A\ff.fSHH܌w/H HcH>@H[7[fDLb 1[H5Y` rAWfAVIAUIHATAUHSHdH%(H$1D$8)D$p)$)$)$3;L׆;#HH٨ ATLn H5_ HHD1ɺ)P1r_AXH}hL|$p@LÅHHH=6e HE1ɄH=?e H€H EHna u(LHDЀ|$pLL$ HLDHt$MHT$HL$LDbH|$PjHT$ H5j` H 8a Lc1R1VLL$8H5a AQL Z_ VHt$8VH5a QH c_ AWVH5k_ ATQSVHL$pH5` QH ._ ZHpHt$h|$PHL$8HT$<ÅD$<(D$8tALLwm 1lH5] rpft$ht$ht$ht$hH H$dH3 %(H[]A\A]A^A_@Ll 1$H5z] pfH\$@HLL$(HKH0 Eu(LH_ HHDL|$pHt$LDMHL$HT$ LDLD$%aH|$PjHT$(H ^ RH] QLL$@H a_ AQL ] QHt$@H g_ VH5Q_ VH5] AWQATRHL$hHQH ] VLD$pH5_ APLc1HpHsH-H`HLÅ1ҾLa.HLcfD$<D$8L=,~nLL$H1iH5[ Lk^ @H11ULL$4nY^D=*m~sLk 1|H5m[ mf=-uLL"k 1ɺs1H5>[ mMJA>fD=(HPL] 1H5Z tmXZDLi 1 H5Z DmE1rL 1ɺ,1H5Z mf.HyLMj YA)HLj )HLuj Li 1ɺo1H5Y jlcATIHUHSH@dH%(HD$81- ;;HH LLA\ H5VY HHDH1ɺP1kHO]H|$ Y^jLc11SL Y H Y H5\ _AX1Ht$(|$HT$ D$ to=.t/xgHH=^ t$(t$(t$(t$(TH HL$8dH3 %(H@[]A\Ð=.tt|H1PL1LI[ H58X jXZfDLIi 1ɺH5 X jH`HL#EfDL11Lh H5W Kj aUSHH~;dH%(HD$81t ~;u"HL$8dH3 %(HH[]DHx[H|$E11LcH #X H5YZ 1FHt$(|$1HT$ ÅtD$ y$L,Z 1H5V xit$(t$(t$(t$(H @1Lh H5V .iL/h 1H5V  i@`AWAVAUATIUSH(Dl};dH%(HD$1EDT$ uJH)DT$ AH\$dH3%(DH([]A\A]A^A_fILY 1I3H1H5U Vh8LY H1L|$Lt$]fDDL$A1ҾL'9ILX 11GH5TU g![AWE1E11AVL1H=X jjUjH0yD$ ALg H5T 1ygDT$ DL$A.tjE Af%f fA@M/1Ljf DT$ H5uT gDT$ Kf.H=n HH=)Z LD$AAE҃E0Lf 1H5S xfE1D$DT$ L4g A-u2LXg fDH5S 1fE1^LVg AtALV 1H5>S eE1EDT$ uJL.2L_e 1H5R eLye Lf 1H5R HeM1Lf H5R eE1eO1LU H5dR @11dA.\AWAVAUATUSH(dH%(HD$10y;IHH$H=Xp AAEEAA$HH= €H= H€1L|$Lt$L-1U \DDL$A1ҾLj#9ILT 11>H5$Q cVIM1ɺ'H5P 1cAWE1E1AV111jH=@T jSjnH0AWHH= tuH= H/L(e 1ɺ4H5iP b;DL$AuuILe 11LH57P bAHL$dH3 %(D H([]A\A]A^A_@uH,$HH= tA.aAvA]H= HA-hD$ƒ8Le 1ɺ1H54O afDH=m HA$AfDfH R@L 1~Q$AYAZM$$M9[H\$HHHMH=uC Ht$0t$@t$(t$@t$0t$(LL$8-H0iHt$@H|$T$l<|$$&RLfY AWLfDLV  H5= ~P$A$$$H ^fDL1ɺF 1H5= 'P2fHHt$0Mt$@H=/B jt$@t$0t$(LL$8H0HAĺ AWLH5"= LA OY^LA 1ɺ 1H5< OH`cD$$/fDLt$H= LvZz_D H=A HZ H=Iw H AW LNCff.@AVIAUIATAUHSH~P `;`;twHHEXHH`HuLMtaH4rZuhH`HuYHUHHuPHM HATML,XZ[]A\A]A^DH0[]A\A]A^Af.HEPHLT Q H58 L1'KAZA[[]A\A]A^H$H%zH&H'HEHcHXHVMtH=? L HK HSHHsPHLA uy@HHEPHLS  LuHH57 11-JAXAY|@HHH4HHHHH@HHMt$H=I Lu E[@HM HUHHuPHLAHHEPHL\R LuHHEPH1H56 L;  1LuH1 I^_\HH%HEPHLR LuHHH~ 'ff.@AWAVAUATUSHH $HhMIHIAdH%(H$X1LMLH5: Q1H5A6  L86 HHt.I}Hƻ0wHHLLLd-H.* H 9* H|$jLc1AWH5. L ) R1AVQH ) AUH0Ht$(1ɋ|$HT$ ͪDl$ t$(t$(t$(t$(H Ey2fDL$ L G 1 H5( ';JD1ɺHL.u* LLF H5W( :HL$8dH3 %(HH[]A\A]A^A_fD1@11HLuq LLF H5' g:Dt$(t$(t$(t$({H }1ff.fUS1HHN;dH%(HD$81N;H+1H|$E1LcH +( H5- 1NHt$(|$1HT$ D$ Rt$(t$(t$(t$(H HL$8dH3 %(HHH[]fubL, 1ɺ 1H5& H, 9L$E H5_& 8YfL!E 11ۺ H50& 8%DE@L, 1ɺ 1H5% H+ x8L+ 1ɺ 1H5% H+ H8~/ff.HGXH$H&H'r{H(rt umHxhH4raH-rZH.rSH/rLSHuGHCXu>H7r7u0u)H"r"H!rH[Ð1D1[@AWAVAULATUSHHL9tVIIL52C fH{t2Hs1LLŅt@J;D$J;LB KA$HLH;L8'H5$ 1H $ H|$jL # LcS1VH5$ AVQH # AUH0Ht$(|$HL$HT$ 蟤DL$ bALaB 11ۺmH5" 5ft$(t$(t$(t$(+H Ht$8dH34%(H@[]A\A]A^DHP@HL-mLL/A 1۹H5! z4H`mH`HZUDL$ H5! 114%DMLA 11QH5X! 3fAt~ED$u;H@BH`'HHLDHH褫L1ɺ}1L@ H5 g3A$L11L5) hH5 /3e*DAVAUATIHUHSH@dH%(HD$81RJlG;AZG;3HfNHL3ÅLLH$H H|$jAVLc1H RH H5& AUL R1SҚH0Ht$(1ɋ|$HT$ 艡\$ t$(t$(t$(t$(HDL$,H AEHH=M% u?W H5? 1L? 1H`HLJf.HL$8dH3 %(H@[]A\A]A^L ? 11ۺ, H5 J1t$(t$(t$(t$([DL$,H At\L? 11ۺR H5l 0VLL> 12 H5; 0%L11L& M H5 0'fUSHHHHdH%(HD$81HHIL> 11 H5 "0!H# H|$jH  SLc1RHF L  UH5# QH 2 R1[H0Ht$(1ɋ|$HT$ ŅtLt$(t$(t$(t$(H D$ x[HL$8dH3 %(HH[]fIٹ( 1L,# H5 I/L= 11. H5 /Iٹ1L= / H5d .X)&fHq @Ho @SHH0 H[ fDHGHWA E1Hp0HBPH8IjfHGHWA AHp0HBPH8jfDHGIHWHHxPHr0HH?hff.HH=p ff.fHH=n ff.fAWAVAUIATIUSLHHdH%(HD$81I@L$D$HP HJXHtHT$1LHC@ŅL|$ H{fHD$0L)D$ _HCHT$ HH9rH)HD$ H'H;D$( T$09r)ЉD$0(T$49r)ЉD$4LL1H{HsLHNPHVHHH3L1ɺIHHHxdHLHrH辝IHHHLH@LD$LL$'HMAWLL$LHL|}XZHL$8dH3 %(HH[]A\A]A^A_fDLq> 11H5: j+L 1ɺH5|: 11=+H@&H+D$(HD$(QL1ɺlH57: +L1ɺ1H5: * L1ɺ1H59 *!ff.fAUATUHSHH59 HHdH%(HD$11H59 HIHttHELHxPlIHHHT$H5e9 ÅL$A@L1H;+ÅHEHHX 3fDL 9 "L< H58 11)HL$dH3 %(uH[]A\A]fDL 8 L< 1"H58 ])MXL< fL1ɺ`1H5Z8 )oU DAUL- ATL%< USHHHGH@PH(#HHvE1L8 IH57 1(XHDE1L7 IH57 1(PLL 7 IEH1ɺ<L7 H57 P1E(QLL 7 IEL7 1ɺ<H5L7 H$1 (RLL 7 IELo7 1ɺ<H57 H$1'XHZaD1L]7 IH56 1' H4H (D1L97 IH56 1d'D$11L$7 H5r6 <'<SMDH11L 7 L6 ATH596 '(YH^4H C1L6 IH56 1&,H4H SC1L6 IH55 1&D411L6 H55 g&D811L6 H5u5 ?&D<11Ls6 H5M5 &D@11L]6 H5%5 %DD11LH6 H54 %DH11L96 H54 %DL1L*6 H54 1w%D011L6 H54 O%TH1ɺ[I]A\L5 1A]H5L4 %fDAUIATUHSLHILd$0HxHHHrH^HHsAHLHFPLNHHt$8LAŅtgHHxgHS1L狀XHRPHRHHHUrAŅtNHA[D]A\A]f.1L1ɺH5:3 #HD[]A\A]Ð1L1ɺH5 3 #HD[]A\A]Ð1Lg1ɺH52 E1#HD[]A\A]ff.H1`ff.SHH7 t [L6 1H5M2 #[ff.AUATIUHSH(dH%(HD$11Åt.7;tGHt7;Tf7;!ЉE_7;HL$dH3 %(zH([]A\A]fHL$ LL$LLD$H5re 7;c5tD$ T$u T$H5LB LHtH@ H@XHt 11LЅu21H5 L5B1H5B L5)~6;D$  f6;eKH1ɺHm2 L 5 PL9H50 1k!AYAZf1ҾLHHX HL- 2 fLcA<$u=H[Htl;tL `5 1ɺ1L H5*0 DLLu 5;H51 Lu |5;fDn5;\5;҉`5;t H4 1ɺPHH1 H5/ PL 4 1L4 F Y^4;4;H1ɺH0 L y4 PL1H5,/ D$A[[I(1t I$Hu1H$dH3 %(u#H[]A\A]A^@HcHDAD@AVH@AUATUSHPdH%(HD$H1IL:LDHt,L/HtD5@2;E~CL%4";1LDHD9t$H}LpuHcHIDfD1HL$HdH3 %(u HP[]A\A]A^$@:HA w HstHƹ H=N5 t2HcHH 8HHP HtOH5 1L@tSt^uADA]tHPH5E 1flfD\fDAWE1AVIAUAATAUHS1H-@I>D tVA t;0LHHEttLtgEt|fDE uAfE tH5o 1'DHUH5U 1 HUH5Y1b@E uH[]A\A]A^A_HH5b 1[]A\A]A^A_f.1?-t -tHI1L\ NH5 1HAVIAUIATL%=8UIl$0SH t,HuLuHcHAD[]A\A]A^M1LR\ H5z  [A1]A\A]A^f.AV@AUIATUSH`dH%(H$X1H$Hl$HHt$ HH߹_|$ ~}E1L%m I0fHTLHtHLHI H9\$ H$XdH3<%(LuH`[]A\A]A^DE1>ff.AW|AVAUATIUSH8H|$Ll$ HHt$LdH%(H$(1D$1A-@H5l LHt uAL$ H9l$~wM|LÅLHI $ u_LHtH|$L@ID$H5^l LHtAL$ H9l$H$(dH3%(uGH8[]A\A]A^A_1ML*Z H5" HD$H0HL< H ]HcH>1VfDH= Hf1GfDH=S HָtH=y f1ff.fAVE1AUE1ATUH-S SHHdH%(H$1ILHH/fD t \tIcAAtIHADH9H3HHt@Et\uAuMcLH5 1B4Wf.Eu AE1fMcLH5u 1B41L繀HHEuH$dH3%(uH[]A\A]A^ff.AW AVAUATUSHXH|$Ld$ Ht$LdH%(HD$H1H5 LGHD$HtE1kD9|8LD)H;DLcN;Hi5H84tHD$ǀ (tHD$ǀ D(EtHD$ǀ (tHD$ǀ ((H|$HHH|$(H4:QHRHH H0H9tWHc0HH.AD uعLH=Si uH|$H0LJ H9uDE~nHD$HHD$0HAQHRHHHHcH0H)AD H9uD$ 9_HC0H0D9pJH9uHD$ HD$ H=VHD$H|$ DŽHH[]A\A]A^A_ff.1?lHut H= HָtT H= Ht9 H= Ht H= Hff.fAWAVAUATUSHH $HH|$ HHt$PdH%(H$1Ht#H==; HEHD$PH8H=n;H(5HHH8HH9uH D$1L$D$lOMAOD$hD$dD$HD$@1LHcHLHH)HH9tAHHDDA݀ uA$  LH=( LH- LH+ LHtH$LHL$L$HL LH$D$EH$*HL M|$HcD$HHD$XHi5HD85pHHD$FLD$8HD$ H8%HH&HD$PHLHuD$8D$D$lD$D$hD$dDH9GA]IcHcD0!L$H=H L€H|$AH=t LH=` LH=j LR H={ Lu EH= LLϾ:DD$0LL$(LL$(DD$0HLc%;LH-;AD$I;L^LL$(HHE:H_H H߾:FHXHHEH_D$lD$hD$dPH= LR H= LlL% LL t$d L$ht E T$lt E D$Iٹs1L[C H5 D$dDHiD$X5H w;$DŽ5CL|$pHJD$HL$1HD$(ADl$xM$EtD$EVL^LH= t$dL\$(LHv;H= Lۋ4€HH v;H@HL؃(HH;l$tRIHHHD$HH'H$H|$H H$H$DŽ$E1H$D|$|L$L|$MIHL$0H$:fD$HH|$ LH`IFM9t?IH;EJ,AtH3HT$0A1LHqIFM9uD|$|H$L$H|$HHD$(H154|$@)447Ht$H|$ LE1D$fM1L< H5 IK0HD$ H$H8HL$HAH)L‡1ɺ8H5v f.E1H$dH3 %(D H[]A\A]A^A_ÐL$EHD$T$HxH8 T$Hދ>H!ကtωT$DH~HD@HH)LdHD$ LH8VT$HH= Lt$HHLL! H1MNSxInXZD$DD$u E!H= LQj@K0DL$EE$H|$LD$D$hD$dD$lXHD|$|H$L$E<HH HELR; QH5l P1R_HL$HH Hq;L0Hp;HB0H('@H5H9QtD$:E1H5a HtHt HD$H0H5U HWD$HFHD$H08ML: vH5| K0)fD$EHD$D5A  HL$AFHE1L$H$5Lҹ LT$8$E1ۅIcHL$LT$8L|$0HD$HEHDl$(LL4*f.AFAID9$`N,H={Lt¹H=n9 LAFA@DT$EuFEtA$Ht$LH|$ hD$D$lD$dD$hH=+ L^zDL|$pLHAٹD$H Lr8 PH5 1AT H 5n;HiD$x5H L0|$E$1DŽ$HHH$HL$uDl$(IL|$0:$IHt$H|$ HEL9%HʼnHuH$LtI!5HGfAWAAVAUATUSHH(H?t$T$H$C0D$5EtH{HtHH5l 1,D|$E4AŅLs@E1H-89DHH5 ¿1I>uR4AI0AD9~\IcVHIH)HTB HRu1H5Zl I>t LDHfDD4EHcЋL$H-ʞ8HRHLd8pH5 1%JH5 L)HDP HH1I|$ub41D4AAI0BD9+Mc<$JML)| tȅrH5m 1mf IT$DH1ɋ4f4Lk@E1H-ĝ86fHH5 ¿1(I}u_AI0D94EeASIcHH)HTB HRu1H5j I}t LDH9HcD$HRHLd8hfDH57 1eJH5j L)HT1BI|$uj4D41ABI0D9Mc,$J<ML)| uAtTtH5 1o@ IT$DH1ɋ4D4wfH;L$L$D$ED$D$D$=i:)H5% 1 ID48:EoDd$E4H4t=H5 1H4H4HH5 1D\$ED4E~L8 E1H-8M4AI0D9Mc0JML)| tH;4~/D;8 tHh HRHH H0D;htH9uH<$tH$ ~FElH5' 1LD$JH5 L)HDP HH1LD$Ix9H5 1LD$LD$H5 1m T$uH{HtH( []A\A]A^A_uDH5F 14tH5> 1E14H)!gAH0D94KH}t H1HH;DD$D$PE1AI0D943Mc7JML)| uH;4~1D;8 tHh HRHH H0D;htH9uH<$tH$ ~BmH5 1JH5}e L)HT1IuH5 1 IWDHD LD$DHIPLD$D$D$4H`(E1fDAH0D94H}t *H1H H5 1 4fDH5 1H-8H;p+H5 1hD$fDAW1AVAUATUSHHt$H5a &H-;4H8 E1L%8I-H5 14AI0D9IcHIH)I Āy H $tH5 1H $1H5H Q HI}Iz H|$IWDZfHH=[]A\A]A^A_ƿfD~E1+H5H 1 AH0D94~HcHIH)M,A} uH5 1ͿIU1H5zb 趿H{t H|$HSDoff.@ sAW1AVAUATUSH(H-;D4Lh D8 A@H@HLDEuHHuH([]A\A]A^A_E~%AA9tHh DH0D9HtH9uHt$I1H5 1ľH=8Lx M@HI8H>AAڅt܋4~098 tȃHh HRHL H09HtH9uA>t1DT$H5k 4HD$DT$4~qHD$98 tzHh E1AA9tPH09HuAIN 1H5 DT$D\$ѽLc\$HD$DT$K[HH@ uH5 1蜽E1뜿 HT$DT$辽H|$HT$DT$H@ DE1II8I%CDt܋4~8DD98 tƃHh HRHLH09ptH9uA?uH5 1ѼHD$4~eHD$DD98 tlHh E1AD9tBH09puIW 1DL$H5>_ zLcL$HD$KIHH@ uH5 1JE1몿 HT$qH|$HT$H@ HH(H=a[]A\A]A^A_錻ff.SHt1HH?H3 H= H=v" 9 ߻H=" # ɻH=$ 賻H=% 蝻H=f& 臻H=& ˺ [pH=! 贺 Z`DH=9 蔺H=M 舺 .fAUATUSHHH:HHItnHuHLAŅt H3HHL[1]A\A]nufDLah1ɺL1H5HD[]A\A]f11bHHx1ɺIE1LhH5DfHA[D]A\A]ff.ATIUHSH?^iHtyH@A|$ CtLCAD$AT$H C ЈCkH][]A\DuCK[1]A\fAWI1AVAAUATUSHHhdH%(HD$X1yHH$HsH߅HHDGfHHD$8HD$HHD$ HD$(H\$0t&HlL<HwtHf HQsH߅A<4+H'tL$F0HxH߅yL-L,L$FHLtH=rH,HtL$FHLtH=R H HL0H7wHL-1Ҿ HfHHL$HT$H1LD$H5y+ =LAăxD$T$_H f D$fD$DoHD$BHy!HHxTHT$ HHo'HD$ HHD$80H=HtHYHD$@ HHHl$0HL$FHtL$F HptL$GHZtL$F@HDtL$GH.tL$GHtL$FHD$(Ht HHD$HD$@@ 7HvHHD$ HH$MDHAFs.H|$8HD$ HtH9tH;t l`HD$ HH9HI`8LqH51A_HL$XdH3 %(DHh[]A\A]A^A_fwLuHHL|H5GA`uGL--HLH=Hdd$FL-P1Ҿ_HqHHavHD$HtHt$Hz\1Ҿ_HA-LIH5Z1rwH蓿L$FBHsLrE DH=M HH€H=H€HD$ HtH=^& HLs+H諾tfDH|$]H_`Kf.I1LH5AsfD1ҾsHH HHDfDHt$ H`H*PHǃPņ LH5hAH|$ fDH=K HHLH=a HH=w H7D$@Hl$0mL]1ɺJ1H5A#@fDLfL1ɺ1H5aAٿ@H蓼fDLY]1ɺNH5A苿fDL1H5\Lq1H5A&CL1H5~Hl$0Ht$ HT$(D$@HLr\1ɺH5'A褾Hl$0Ht$ HT$(D$@H`L!\1ɺH5ASpL1H5*H=HH=F" H H=HD$@Hl$0Hl$0Ht$ HT$(D$@HzL;[1ɺH5AmHl$0Ht$ HT$(D$@ H)dLZ1ɺH5A9sHHl$0չD$@H=HuD$@Hl$0H5HuD$@Hl$0۳)1LmH5y@HcHfUHSHHH HP1H5R1IL!H{PY^ޕtH{P!qt H[]ÐHHHI$PL1H5!茻XZ1H[]ÐH HbAU1AATIUHSH-E^t/Et*t u`H[]A\A]fDH zÅuA$ uH>@3u A$@uEui1DL蛷u1H=tA茰t8At2At,L}1H5HõDH߉t2H$dH3 %(HĐ[]A\f.HXuHADHH(PtAtAtHCX u@u@uiHH-V1H羀H׻1LH5H(v@[HELPHIEHLH=H1L|IEfH(LUIH51qH{PXQS@u)u [11É[fDÅuLO1ɺp1H5fAWAVAUATUSHdH%(H$1HG(44qIIE1$D$D$ D$#fDIF(A44D9IcLHTRHl)tH$DŽ$H$HH$HH$$H$ H9uI|$P>D l? |  ID$P1ҾD$H8cLi4IT$X @P9PL$$fDD$ fD711ALLD$<LL1ɺ!I5f.  |'1Ҿ'LD$HIT$XHH39HH3H3HEƒL$$ID$Xf  DD$%1ҾLŃvID$PH@H@@Yt EvEA߉1A AA9HD SL1ɺH51E脮_AXE;|$p*DAl$pLH1PA1LH5Ҽ=L$D$XZ@=?ID$PLD$H1GHHʪ=H赪ZED 9E@ L"1H5:襭LLD$4$@_G yzID$PLD$L851LHZLL蠩D$$ HcID$PHHxHD$HIo@IG@1HD$H9Dl$(AH\$8Lt$03HM1HH ûAHmH;l$wH]H1t1ҾHIHHzHL$IIcHID$PIvHxHHsI^C|5:RLH|bGD踪L7IH5H1豫@L$tZ$L>I1ɺL1H5 tH$dH3 %(H[]A\A]A^A_D|$ ED$D$ H1If.HcLHTRHDlD货H H$H$H'H$HH$HH$HG=H$H_DH$H H$H L$H$AH$DHA9uI|$P7 A AAA$q襨yLIH551螩E1ҋ4$tTL$ tLLDT$I 1M~LH5@11MD$ DT$DL IF(449L$$D$9v n I|$PGtAuoLD$D$`,IH@@IHT$`LHHD$Z D$`$E1DA$LD$LA…D$1ҾLE1LA+ALD9o+$AD7fD$HD$XD$PAD$[L+IH@H@ 2ILl$G^eHL$LHT$HLHt$PLL$XLD$`k/ IEt$L@ tI@^t  t)HD$9Lt AD$^VL w Ht$`HT$XHL $AH|$XH,DT$mBDT$fLD$T)D$`)D$p)$)$)$m*HT$THt$`LI( D$TU$1҉t%A AHT$`Ixt.$A AHL$hIt.$A AHL$pIt.$A AHL$xIt1$A AH$I t0$A A$A@t0$A@ A$A$$΃@  LDD$>1H=L)1ɿH5H[]AL)1ɿH5aыkAW1H AVIAUATUSHH8dH%(HD$(1*?HLd$eLH H2AŅGAǃHL+c1L=H譥HIHHH{PHL$ӜH AVHL$HL HDQELpAWLDH5>1Po1褊HEH HPHCXuHH%H*HCX 1HH4@HEHH@PHx[IHgHEHpMLthHHx1Hu%qH4RHHH|2HQM<6D$ILLeD$;ELrfH5gHaYEHCPHH8L'1ɺH5ڗJD1)HLVDfH#L辅u!HrH=H11 LfLL;Ht$(LŅwHT$$Ht$0LMŅLRHt$(LFLRSLL#E1҅'H{PL9X^L$ 1LaHKHH|$1HhH{PHT$Ht$H;LHt$(H_Ht$(LL73LgLH茿.HT$Ht$(1L`;H{P?>H{P~H|$(~L1ɺ IH5Ϳ1cLHt~L1ɺ IH51cADL2 Ln$ H5FxcE1w$MOHL%D H51EcD$CAHD$(LԆJ H5ɾLHH1bL$p}g L/ IoH|$($J}Z L IIH|$(1%}Lކ` IH5E1pbT$$H߉$|LEIPT$H51RQ 1bZYL$|L@m IL1ɺ| H5aLKHLQ1 H5aE1XHLJXLIwX(xH{P$L51ɺ LL$L  H5'TaE1S$L1ɺ $L1ɺ L1ɺ $L1ɺ XAUH7 IATUHSH(HNHdH%(H$1H\$HmdLxKL$H}PHLܯHtHHT$ L1SÃtNLoH5118`H$dH34%(|H([]A\A]ÐL$ HL1cLx1LHLHuL1ۺH5{_kVff.AWAVAUATIUSH(WTHt$HvPHHD$"jL[D$ YHct$ I|$HNL1ɺgIHI\$@Ml$@1I9t]LsjL]t=1ҾjLiH#I|$HDuI,莒HEHAIcHL9uHD$I|$E1LT$ HpP)HHuL[HL$H|$Hډ¸H([]A\A]A^A_fDHGXHE1HHHD$HL1ɺ_H5¹]DL1ɺdH5]H([]A\A]A^A_DLnH5\]H([]A\A]A^A_f.L1ɺrH5Q]H([]A\A]A^A_L1ɺy1H5]H([]A\A]A^A_L1ɺvAWAVAUATUHSHHdH%(HD$1HGXH~PHH$ HCPHHH膱L,$HwH{HLIStWH=kAč@=wAD$DL1H5\)@MLH5Ʒ[1L1ɺH5[DHL$dH3 %(!H[]A\A]A^A_DHCPLH5ML1q[f.H{PDDHwLn 1ɺIH51[H{PL;IH7H!LHLfuL"+IH51Zf.LI1ɺH5OZL1ɺH5QZY@11M0L݀H5$Z1H51L1ZHVuLH=CHHEXHu)Hx$H-HHtzf.AwWDHਸtHH-MtI]HnqH L~SI1H51VXZH[]A\A]ÐH(qLDgIH5F1qVHDHEX"ff.AWAVAUATIUSHHHnPdH%(H$1Hf1Ҿ\LXHD$ HHT$ HL轪Ht$ HHHDH9HL{PLsXAʼn |AUA H.,HtHXHoHH5SIL}C 1.U^_1L1ɺH5ް UfDH$dH3 %(uH[]A\A]A^A_HHEY@>uHEXHHoLA}X IH531^T-fHCPyL[|L1H5!THnLO|IfUJI%I-H:L[ HKHALl$0LDH 1LSWHsLICPt91ҾL@bAA;FTtHD$DT$EVTLOu3HmHHD$mHT$H=<}H1ZTHDHH5ه H߉$P*H$ HidSt.H$ H@ H@XHtH1HAąLrL|$0IMXHT$HLIG1LH|AąILHNHOAąqL^H1ɺ^IH֠PL/r1H5CX1ZH51cLKrCH!@LD$DLLH?AHHHLZHHA]LH]He1IٺL*qH5Ԟ@H11UB_AX9MLLpH51ABH$(dH3 %(D@H8[]A\A]A^A_@L]H1ɺ^IH`PLp1H5PBY^1H5 1aL"i-BH>fHH)D$)D$ HD$q>H߉D$$`>LD$(t$(t$(t$(t$(dH LorH5TAAEH$ L' H5!LH(1HA1ɺ@E1LH5AafL1ɺ91H5œ@2f.L1ɺT1H5@f.LY1ɺQH5_A@fDL[WLHIL 1ɺn1H5 7@fLZH=QgH1w HD$ HH 1B/L" rLT1 H5L+E1^@IHD$HI|$Ht$^IvHI|$HD$^Aon Aov0HD$0)$)$LE1`AZf.IHD$Ht_I|$Ht$p^IvHI|$HD$]^AoN AoV0HD$0)$)$HD$0 fHD$0fHD$@HD$HL$LT$tLLL$PH$H$HH$MHD$`PHt$ LT$5XAXZEL$PAHD$pEDD$lIuXARLH$PSH$PHL$0wBH  DL$pHtD9 H1ɺ D$|LaH5P1$)AZHA[CLHD$PCLL$PH$ LH1H<$H,D$8T HHPHSPH 1ɺ PLL$ 1L`H5U(H 11L^ H50b(Hi HD$PL$H>HL DD$8EHLYLLj IFHHT$(1LLHD$8 H|$8MH@ H@ HD1p~HD$(H Ht$(HE11ALNXjjjjjQjjjH|$`n%HD$`HPH* Ht$(HHt$Ht$(H|$AIHLy LYj IdžHǃT IH5( H  HD$(H5HHt$T$t$VT$$Hdžu HD$(HHXt$xH|$($ 'L" 1Ҿ'L4t HD$(HhX3H$tHT$ 1HL H|$H $LHT$o L L E 迈H5A LQt$XLL$1Ƀ1Q%^A_HT$0HtYD$L LLH$AVjLD$(HA_ZD$ LD$HT$0HLLD$:D$HT$@Ht\D$H$L S LWHLjLD$X3AXAYD$ LD$HHT$@HLLD$D$H$HD$D$wD$! L$LH51)$D$:HD$@HD$HHLt$`t$`ARH$PH$PSH$PHL$PR H@[$Ll1ɺ H5w1#D$L$& LLHT$|LL$H$L$L$_XL$x$L1ɺh xH$H_D$p^=9 LAXID$L1ɺd %H߉$_=? L\6 IzH1ɺ HLNn PH-LZPH5J~1ARLL$ s"H LLn LT$PH4$1H=qIlHLL+LLXqtYLLHt L1ɺ" 1H5b+fDLhvLC1 H5bML1ɺ 1H5bIAV1AUATUHSHH LnPdH%(HD$1HD$HtHT$IHH[(Ht$LsIH@\ C^uGLHH)¸BHL$dH3 %(RH []A\A]A^fHȉH載LHt$ HB%D$ wH& LBDYIH5Da1o2f.HpAƉ+AVv A L9RE1MHLHuHt$L0IH5@\ HrALBIfD1H5`HHH%HLBUIH5C`N1iZHYLBPIH5 `18$fDLѡ1ɺH5_ L1ɺH5_Lq1ɺa1H5z_jfH\HtHXLHH5F_SIL@1+\^_FLL$L amDL7L@IGL1ɺUH5^@Hh1L?@ILL$<L@ff.@AUf1ATUHcSHHXdH%(HD$H1I)$)D$)D$ )D$0vLH`bHV1ҾaH HHEX1H HH_E\H[HEHd1IٺL@H5\]@11Ƀf1HG HHLmPsTIHMXH 1LH`HH=d1IٺL@H5\@11Ƀ@@1ҾbHY D$ LY1ɺH5_\HL$HdH3 %()HX[]A\A]DHCXH{VE1LHHHHL1ɺfLٝ1ɺ1H5[yDL1ɺL]1H5[6fLi1ɺH5o[ L>DL!1ɺH5'[Yf.AWAVIAUMn@ATUSHHHt$H|$pHT$1HL$(7dH%(H$81H|$ HHLHDŽ$DŽ$H$HƄ$DŽ$H$XHDŽ$`DŽ$x I^@H$L9H- E1HD$-H<$AIcAHl0HL9L{Lt1ҾLHH8@tIHLf.H8bL/I1H5TQH$dH3 %(H[]A\A]A^A_L1ɺ H5P11Lؒ1ɺH5PL1ɺH5PH|$8Ht舐fDLy1ɺZH5P+HxHHhHL^01ɺIH56P1a@L1ɺzH5P9H|$ gLqRIqDL1ɺH5O[Ly1ɺ DHD$E1LI1ɺ}H5OOL1ɺrH5OQL L4I H5N1H|$8H&fDL1ɺ DLL$(LXO]H5N31Ҿ]HHT11L  H5BNo1H5/N1L  NHJH= <LHHL LI HKS1I麌L5H5K@H11ATAZA[MfDHLsLhL4H5QK1wfH-sHE(@H{P|H LI H1ɺAUI1L;6H5J^_H{PzL66OHLl$pIt$HH LebL5 L6x 1ɺIH5VJ1H{PxH{P跣LHHHQ1IمLA3H5I@H11UZYfDMuM~LcfHt$ HHT$)D$ )D$0)D$@)D$P)D$`0H{PX{Hx#D$ AD$[D$ |$hy D$PH1D$ uHHV 1HH!4 tP1L0H5H@11 H?'1HH3HHӴHh AL$  HM(AyuAHLEbDHE(xHcFL3H5HPB 'HXMHLfLJILJH5G@L 1#fH3H1H5FG1L.eHH2HHkN1Iٺ;L/H5F@11l@L90SfIEQ1LH趥;LY1ɺH5_FHhnIHHxG[ M$L@nHH@@[I$nH@[C[I$mLtfHHpI$ImLH1ɺAVI1L0H5nEAXAYH#H1LeŃ*I9HHL1IٺL>0H5E@11'AfLɆ1ɺH5DHLHҞÅ1LH軣à LHLI=HK1I麆Lj-H5TD@H11ATu]A\DL1ɺH5D1B\DL1ɺ8H5C.L1ɺH5C1LLHhx?Li1ɺH5oCI$skHHxL-1ɺIH5$C1Of.1IIL,1H5BI$I$jHwL,1ɺIH5B1fDL@L(1ɺIH5aB1HL(1ɺIH55B1`LBf.L1ɺhI1L)H5A@11D$ HHOL1ɺ2H5AnH1H5tAL(@111@HLILH=N(H1/LAEHEE^H@HHEt}Lt IV:H= HHH=Y HֹH= €[AQ}A~dMu uAN`Av,DHDT$WDT$HDT$RUtFDT$Eu6 1H HHUH|$8tHt$01Hw H/LߕLl$0HD$E1fHH)D$@)D$PHD$LH߉D$TD$XAEYt6HD$0L$Hs2LHHH1Ht$01LH`TL|$0IIoX4E\ D$,H5Y H߉D$HD$HI UXLHH p2~rHL0LEWT$HL$LLhH HHfoL$`foT$ppfo$xfo$fo$Ls0sHN` 1HHWHT$Ht-LL -` MHH$Hj {Y^7HH51IٺL@H5.11A@HH];H蝿eLHH跒BHH;u Lo1ɺKH5-Lyo1ɺLH5-1WDH|$0fNHQuH|$0H=H1+1iL|$0Lm1ɺLl1ɺ H5*&Ll1ɺQHD$IHIHAVL1AWI1H5*K_AXHHHHI9HkH=LW IE1*H|$0&LEIDLL$8L)H5(Lj1ɺ^H5(iLBH5\(HHn6(Lj1ɺDH5%(WfH|$0xL IDHH 6Li1ɺQH5'LxL,IH5'1Lei1ɺ`H5k'EHWL I Li1ɺ|H5!'NHM$L t$H5&XZ1H5&LhLH4 fLyh1ɺH5&LUh1ɺH5[&bAWAVIHAUATUSHHHLjdH%(HD$81LHHI興HH@XDEML|$E11ALHL?ID$H@ H@XHt1LLЅ3H{PZWHzjLHWH/'HEP1H ~ HHxn.HHHH,1IمLPH5$@H11UXZHI|$HI}HHrATL IUp5fHHHH=HLUI~H5V$1AXAYL&f1ɺ1H5/$\HL$8dH3 %(HH[]A\A]A^A_@|$=t$(1Ht$ Ht |$ HL@IH5#1KLie1ɺH5o#@LAe1ɺg1H5J#wfHHHHLIUw1H>1H,rO*1L @1Ƀ1H5"LH蝆H{PԠtH{P|YLhd1ɺ1H5q"fL H5<"nf)1L@1ɃGDE1E11LHLrtL$uZQ)1LH5!@11DLc1ɺH5!?HDH(1IٺL$H5[!@11HLwHHtI};AMLc1ɺff.@ATIUHHSHǁuCC\uHuLt []A\HHvu[]A\LHH[]A\>ff.AWAAVAUATIHUHSHH(DD$ LL$tHHIH߉D$MJ}hD$u CY9H{P0M`H IAHCPE1L狰AƅDH+HHCXĀfD9|$KLoHWH߉D$sDT$HCZ@DD$ HL$HHLLItHLvbMpDE+T$jHLPt$ jDEtH D$ TH GHHHhH]DT$ trHDT$ DT$ tHLDT$ ,DT$ tCHDT$ +DT$ t-H{PDT$ 詜DT$ tH{PwDT$  HDT$ LIIH5+1VLUH512DT$ EA@HLLIH51E1H(D[]A\A]A^A_@Ly_1ɺH1H5E1f.T$|$ D)uMLHu@HL$HKD$ L^1ɺH51-DT$ =HLi1ɺ@IH51AfL製HCXĀtT$ 9T$tHLAfMpjAWEHLPt$ D$$PDEtH D$uL]1ɺa1H54DT$Df.LiH51E1@1Ƀ}h`fE\HCX HLHLjLL$ AXZEDT$ LI]1ɺMDHDT$ L IH5)1TDT$ df.HL$AHHLJHnD$ L\1ɺD$ L\1ɺHx}L IItHKX@E\D$ LV\1ɺZD$ L= ;L)\1ɺ-ff.fAWAVAUIHATIUHSH1u Hu>Hu LՇÅHID$XHHH@HuH=x Àۅu#L脺EEhLLlCAID$PLMtH=ϰ LDuEu D]EElDuh3ADuhA)E(A9t0ML$HL11DT$H5DT$AD$Yt }dHE AECuutm1҅HLDT$4A:1LIH5;1fL)DT$LAD$YE9v A9A9 E9LEDHLLUÅSM\LxH 1IٺL @H511豻@M|Hu>oH=( L CH5&11O(DLX1ɺH51%H[]A\A]A^A_@H&L l HLLDH1H L PH51ƺXZfD}EEd]hAzDjLS 1H59fLu LW1ɺ1H5/f.E9AD$YI$DT$"1DT$L\L` "IH5z1襹L1&L IH5D1oEf.H1IٺL @H511$ADuh@D)AƉEh@ALs 1H5ƸLoV1ɺ1H5x1裸yfD1ҾLiLB1H50]3U`LDT$ T$,LoHC HKHsH89HHhHEX@qH1wH <IE@uHp(H=o 1ҾLnIHC8tH=~ H€HƹLL^MGLLL&HC H@u HH[]A\A]A^f.H7HpHs LQ1ɺH5ٳ[]A\A]A^LqQ1ɺH5w詳[]A\A]A^þL^M7/H=L L!f.HC L LH(1H5$[]A\A]A^LP1ɺH51LWH5ɲHHLQ~LouܾuL^u˾HLMuL<uHsH= m tHC @HLIHLIHL@IL蟮uL芮yHC H@hĀ_HCH= H€A[A\E1ҾuHElEhDHuH^LML`uJLuAą7H蘦"L H5l螩XfL H5:1E1bDHc1ҾHEdE`HuHDEEDe ELMLtuLTtujHhAHA1H5 辧ZY=LMF1ɺ1H5V胨=fDH;LB H}uhHG HEE1ҾHڶ1ҾH߉Eh舷ElWHHEdE`fLiE1ɺ1H5r蟧Yf.zHSteH HEL< H5FLD1ɺ1H5HݣuHt/L,HtWHH\6E11PHSAjHj+H HL$dH3 %(@H([]A\A]H= THtH]XfH}LHD$HHT$Ht$Ht]H|$քLH˄H}\HcHIHtVHL$HM1HW7H$x6H]XLcL/1ɺAH5 41L FH5 L/1ɺ>H5 ݑff.AWfAVAUATIUSH8dH%(HD$(1Ll$)D$HD$ MuL1L^HD$HL|$MovHIT$X1A$H[E1LPAjAWH ߉3D$tbH\$L9tXfL賍L{Au#@MDLL H 7 :H9IELH9uHt$LHL$(dH3 %(u 1iD $GD$ 1H5 1LN 4L LHhH$tD$ tH4$1HBLvI1M麹Lc H5 @11贇AfLH8L6%1ɺH5< n$L L  u~DAV1AUATUHSHdH%(H$1HHLHHD$DŽ$L$L$H HXHHI]HHUXE1Hi1ɾPH.AHPAUiH AH$L9t=fDKD$X1HHsAȃAA@OHA9DLL9uLHVH$dH3<%(DuoH[]A\A]A^L#1ɺ*H5 A軅fL 1"H5_ A膅{|ff.AT1USHHdH%(H$1HIHI$HD$DŽ$H$H$HL`LHHtiHHE11PHPHSXHPAU H AHHH$dH3%(DuoH[]A\@L)"1ɺ{H5/ A[fLA 1rH5 A&{\{ff.HH=E11PHWXAHOPj H(AT1USHHdH%(H$1HIHI$HD$DŽ$H$H$XHL`LHHMtiHHE11PHSXAjHU H AHH\H$dH3%(DuuH[]A\f.L 1ɺH5 A軂fL 1H5_ A膂uyff.HHG HWXE1wTA1Ɂ`H4ED$L)EuzՒIl$HIAU1ɺUIL H5 1.wZYD$t  DHT$dH3%(H[]A\A]@[HIl$IkHAU1H5+ UIL; @Ǻ11v^_sH L 麚I1H5 lv1RDHL IfHȐLW I]mff.fSHdH%(HD$1HD$t(HHt$HtiH3T$9uHL$dH3 %(ucH[fH(L IH5 1qu1DL1ɺH5 Iu1lATUSHdH%(H$1HH@V,HH HH5 L S4HEttIƒuLp H} LCXH=^ H~ HEL ; H w MIVARLP1RH] 0xH <$u>H@@u1H$dH3 %(H[]A\f1ҾHHtDH@@Hh($1LK IH5 @11sHC\DIIH f.1L }H5m ls1D1ML H5: 9s1mjff.fHtkATUHSL'HMt LQjuH][]A\HM+1SLz H5 rX1Z[]A\f.AWL= AVAAUE1ATLUHLSHHHHT$LD$dH%(HD$81HǃnHnHHCDLHf,HHH@H @OjAA1hHhH5 hhj^j]j[hhhhhhjUjNhhjKjDj2j.hj#j"hhhj jhhZqHADž0[CH@HAH1jA hH5 hjhhhhhhjFhhhhhhhjUjNhhjKjDj2j.hj#j"hh~pHADžHltO{$jAA1hHhH5 hnH 4s$AH@AHH1H5 nLB 1ɺ H@HA H1jAhH5 hhhhhjbjcjahhjGj=jFhhjShhhhhhjUjNhhjKjDj2j.hj#j"hhnH01L^ )HH@ D;ExH)ĄdH;"HD;H@EuHHT u D{E | HH@ H@XHH1HAHEH@ tL( tJ@tLt) tL H5[ 1E1UmjAHhA1hH5$ hhhhhhj^j]j[jFhhhhhhhjUjNhhjKjDj2j.hj#j"hhhj jhhlH01L8 pH5h 1E1blHL$8dH3 %(DHH[]A\A]A^A_@1ҾHYnIH C$HƹH=& E1AŅH LDH1H5 jLn 1ɺ7H@jA HhA1hH5 hhhhjFhhjSjHhhhhhhhjUjNhhjKjDj2j.hj#j"hh+kH1LfH@[jAGHjb=A1jcH52 jaiH 1ɺL<HAH1jAhH5g hQiH 1ɺL#fL1ɺDHuHCf1Ҿ9H- CC 1ҾL{HHkHSPLHHCP+ 1ҾHkHHC`HS`LHXHHPH EVH{`UH{HLC`HL{PH@H?Mt3LLHL$ LD$G`LD$HL$ L{`HCPH{H`HA=H1jAhH5 hhhhjG`xH@d jAA1hHhH5T hHDL$ cDL$H1HAƒ tSpD9D;$SHbCtHHHP1ҾHtC|IHHPƀYEt {ptru HD$H8t]H tPCx(PH蹁L{ 1ɺIH5 1d1ҾHp HǃshLm@HE@L9tkH\$ D|$IfI]H?ct2H1Ҿ,oHHH}HL!7%MmM9uH\$ H@-HD$HL$ADp HHDML 1E1WH5 cwf1ɺTE1LjH5 cGfjAA 1hHhH5 hhhj'hjj$hhhhj^j]j[jFhhhhhhhjUjNhhjKjDj2j.hj#j"hhcH0ADžH_uH_( [Hv_CHZ_KGS$` L5 1DH5I HbH5O HHHH@H^H^tsE1L=S L1ɺ]DH^mC fDL 1H5 a%HJ^xfH3^E1L=_K@L1ɺ)D'H]HLC H5 LH(1`1HH5 _+ HH@yDLQ1ɺ1H5 ` fLXH)EHD$1HH0w/HHD$0HD$VHT$H4 L 1H5 _fDL1ɺmDHA H1jAhH5 hjj$hhhhj^j]j[hhhhhhjUjNhhjKjDj2j.hj#j"hht_H1LAǺTHCH@AH1SH5\ ]ADž1ҾHejYLV 1H5 ^2@HS[H>[L" H5@ D^H1H5 -]L1ɺf1A$HAH5 \HH@IjAA 1hHhH5s hhhjjhhhhhjFhhhhhhhjUjNhhjKjDj2j.hj#j"hhC]HADžHYuHY[HYL 1oH5 \;DL 1H5u t\ L1ɺ=H5E I\L@C s@HH@f.L1ɺ1H5 [f.L1ɺUDE H{HLC`E1HL{PMM}fHCX;HH@L1ɺ1H58 7[:fWgDHEXFN1LP H5 ZML{PMLLRMLg H5 Z@HKWH6WE1L= NL1ɺCH5% )Z,@L1ɺjLH(Lj@ 1H5 Y~1ҾH\HM1ҾH[9L 1.H5 Y)jAA^1h][Hj'H5п j$hhhhUXH@L1ɺ:1H5 YL, 1VH5 XHD$1HH0p/HHD$0HD$NHT$HaHSXLHSXH萭HS`LKXHXLHLL$ HT$OHT$LL$  HCXHD$AH{HLC`MHHTHHQL1ɺ^1H5 W}LKHL H5 WHD$1HH0n/HHD$0HD$[MHgHT$0LHb@HS`LD$0Ht'HLHT$ LD$NLD$HT$ < H{HLC`HHD$AHQ_L @H5 VL 1H5¸ V1H fHL$HHAL;1ɺ1H5r qV E HD$HSXLHHHCX8aH{HHHD$ALC`HQjjAA1hHhH51 hhhTH0^Lr1ɺx1H5 UA1HYsLHnH{H8L| 1~H5X WUZHL'L1ɺ]H5 U#DHT$EHLxLC`HLL1ɺH5 TH<EAxAQ1HTrHCHHcHHQL 1H5T STVD;KpbL ARq(H5 1T_AXLI(APAWL H5 1SAYAZLQ 1UH5 SL`1ɺ1H5 SHTPH?PE1L=m WL 1H55 4S7LK`C1ҾHaHDL$PHAZ 1L H5 RLe1ɺbH5 R1ɺFE1L2H5r vRH4OtHT$0FHIC|L> H5 R  Hǃ`>L1ɺH5γ QKp <cp@t {tH\NHtHPt 0H@ :C|L1ɺ1H52 1Q4HMHHD$\Ct L$蜫1L IH5˲ 1PHHP3La1ɺzH5 Px?DL$蹳L H5] 11UPHDL$HA-L PRg.L1ɺH5 P1Lu H5 O}L1ɺH5 OHSlL4 1ɺIH5 1OHǃHL(1ɺH5\ `OcF1H mLH!H{H1L H5 O1Lѻ H5 ND1LD Sq(AL_ ASq(u1LG H5 N1H4lLHIH{H_HL H50 LH(1)N,IL* E1H5 MHLH(RAPL HHLH(F1L 1ɺ3H5 MCpH1L H5Q D|$PM1L H5% )M1L~ H5 M1ҾaHXǃPbHIcHI1ҾcHNH`HDADž_L21ɺ1H5i hLH&IHIHH*1ҾHE1I LH(11L) 1ɺH5٭ KCpHLH(B1L H5 KLH1ɺ1H5 ~KLH()1L H5K JKL1ɺH5% )K,1ҾGHY1Ҿ=H艃Y艃;tCt9C|bHtgs|HHD$(dgHD$ HLH(LL$HL$(H5 L QHT$(11RLL$(]uJCtC|Y^L1ɺH5E IJLLI(LA 1H5 J!1L; H5 IL11H5׫ ILH(u}1L 1ɺ;H5 ICpH1ҾHXXu]E1L=i d/1L H5? CI71L H5 IxHWH1E1ƔI1ҾbHsTl1L" H5 HLH(J1LĶ H5| {HV1L^ H5P THff.@AUIATIUHSHZHHxHPHu(HU`Ht ]H[]A\A]fHu`Ht* nMtHu`LHHH@HH)uMtLSDtLP +fH][1jA$A^H5Ъ FFAYAZHHxHPH]Hu`!HthMLHHHR tv@] upHPaL DIH5 1F@]L 17H5b aFm@[@\ QH`Ly IIH5 1F"HLH(1RL1 H5ߧ E_AXH[]A\A]H}LV "H5 11Ef.L91ɺ1H5p oE{f.HȵÅL1ɺ1H5. -E9H}!KHE`HEPHA$11LM`H5צ L9 DY^HLM`A$?L H5 DXZf.AWAVAUATUHSHHHdH%(HD$81HAL(L`HXH$=1ҾHA S'HAE4@IBAXHRA@wA 1AHEIMIUHHpHf@.HQ@tAM, H;@3E]EIHH H)s!AEHI9t$hLHH LHI4$H It$H$AT$ WEL$HIArHW JcH>fIuXHHHrEEI<$Iu`HjHbHH@\ Lȳ 1H5 AH}H5 [IHZAEfDEA9LHAE1AVLV 1H5 AA^A_f1ҾHc@AM,1ҾHLAM,f. HLE]AE0E|@L1ɺ H5բ @L11H5 @H<$uHXHt1HH\$8dH3%(/HH[]A\A]A^A_1Ҿ'H9OASDIu`HCHLu_IH@] IL<LaVTL<tII3GX%H1jAALH5ױ >ZYLIAE4HLLIEPIEIE`IHHfDE|$ E2 Lu HLHD$;H9D$Q I1HJ  AEp1AAEpmL 1H5 >* Du EEEAu!jH} hAA1H5 2=ZYAD$ IHHIEPIE`EMEuA}L 1H5 =fLI1ɺ1H5 =f.AA@L 1ɺH5= A=@1Ҿ;LY) H9D$ IHJ+E}pfHA@Ld H5 <H}7YL{ [IH5s 1pDQI}ElEeAuptBt<A9v)Aupf rLD 1H5 2/fAE@#HHݼiL) H5/ 32vfDL 1UH5 2AM IHA>IE`IUHL H5 IL] Hq(LE11R1^_zDHt$H}NL IH5V 1S1L1ɺ1H53 21uDLq 1BH5 1H9T$_IHJ @\FIHBLʡ 1H5 0DL11ɺ1H5h g0fI@RL 1H5% $0B9Hr(DHLӣ H5 1/AZA[DDEt$ EtHfLI1ɺ/H5} /L*1ɺ1H5a `/L1ɺH55 9/4@L1ɺ1H5 /jf.LI 17H5ݐ .HDIAEIEXHH^+IL_ )IH5w 1t.H}IA&L1ɺH5' +.&fDL! 1H5 -WHMMXL[ wH5 -AYAZ/Lɣ 1[H5 -HhHH@HIE`E@MM`e1IEXL H5, 0-I@fL 1H5 ,L1ɺ1H5 ,f.L 1 H5 ,ADHIAH}IH HH}IIHAVL ATIMH5 1 ,AXAYL1ɺH5ݍ +@L1ɺ>1H5 +1fH8FL IH5 1+@La 1H5U T+pLП 1H5, ++HEL IH5 1*jHHIHeAux#LL跔yLGELS XIH5 1* LL谓2LEL SIH5L 1I*L 1H5!  *Lܠ 1qH5 )L1ɺ!H5ϋ )MLw1ɺH5 )L 14H5 )L*1ɺH5^ b)LL6LC1L GIH5! 1)IHHMMX31L H5 (HMM`H5Ê Ln (^_"L2CL MIH5~ 1{(MMXLk 1wH5Q P(KfDAUATIUHSHHHAL(thIuPLudAF0u\tt$ tPAFENAvM1ɺPH5 1H=PL9ZYLDH(1[]A\A]A^A_I1Lߖ H5 H(1[]A\A]A^A_DAWAVAUATUSHH $HH $HdH%(H$ 1IHI-IJID$8HWI|$ HH$Ht$ L J91Ht$IH$YILRAzt7DZ IHFLE1EAƒDVDR EAEH FH9~WLcT JLL)IDR EtEZ tA@:IyDH$Ht$ Ht$IH$Hx[3H8* Af)HH[31)FID$@HD$fDHL$H$E1IuA>h ADžA?AD$PI|$HJ<L 2I9Hp LT$HL9Hc>HIH)I,E uA9uELM|$8E$IMǨteHtBtttE(9CsBI|$-LD$GLD$HHE(H|$HLD$CLD$AN|At E$AHcu t:HY3HHH s6IGHLLHP`AAxHLW E1AWH5! _E1AXH$ dH3%(DHĨ []A\A]A^A_ÐH Y3AA)HX3HcHIEf.E1L\ H5 E1qL H5j E1GHUE HH ΁ L L HL RH5 QP1H E1$LMH HOX3L1 H5Ռ 01NXZD$Ll 1H5 E1zH & IFuH & HI+H & H@SHs,sxnn[vfDATAULN S1HdH%(H$1HH 1H10y4H5E9H$dH3 %(H[]A\fDH5D9ARHc؅xsDtZ8<$IH W% HHDHLPHBWH5 P1R xH C8L<$IH $ H2HDH1۹PHELPH5 1R H +AAVIAUMATAUSH0dH%(HD$(1 t0t:mHD$(dH3%(H0[]A\A]A^@#8 tхuH 1HAٹ L_ H5h39H@HHN39tg8 b H- U3L39IHȏ 1H}@H}MDH 1#fDH-T3ML29H> H}fD29RH7u >t*Lc 1ɺn1H5̈ HE DHff.USHHdH%(HD$1HtH$8tnHhH,$8%t%1HT$dH3%(H[]H5 HtH5 Hu"C,H9C  DH5gHYiH5 HBRH5H+GH5H0H5ئHH5) HH5 HH5hHH5gHt&H5HtH5Xo H{uHHeH@IF(XIcĹKH5^c9Hi5La LLH5U 1H5939@La 1>H5MU 18ff.tHcHHb 3f1ff.ftHcHH3f1ff.fH5ub91HNDH5t99uHcHi5H@1ff.fHH@ L LV H5PT HLE11HS1H5T L L`V K H`dH%(HD$X1HnPH1u]PH`u|11ɺP L _ L=V H5S $HT$XdH3%(uhH`[fILU 11M H5_S zILU 11O H5/S [fAVAUATUSIՃtRH1AA ID11H?EDH9[D]A\A]A^DHH=~ H€uH3H8H Ht&@Hà ҾH`Hu1A LT 1 H5R Lb 1 H5Q x1L H5Q T 9~R1L%zT H MHr 9H5Q HHà pL1;-L 9XZ|A[]DA\A]A^fDAWAVIH=T AUATUSHht$|HT$pdH%(H$X1H1p7 =HD$pH8I~HB IFH H61ҾmL~14I~Dd$|Hl$pA@HA9HD58-ux-uP HAH D-t#H9tHHt=uE1EtHuH9tDd$|Hl$pHA9vfDI~jEAD$1L=-IH$fHCH9$HLl LHI~L/LlLI~LHI~LfA9uI~H5B @XLAq1ɺ H5N yHLI~LHuDLp1ɺ 1H5N /LQ 1 H5N  I~IFLp1ɺ/ H5^N 1@H$XdH3 %(+Hh[]A\A]A^A_DI~H5@f +i!I~IFHsI~TIF HHT$pHt$|LUAo(LAo8AoHAoXAohAAoxAoAAAAAA.L11L /LP B H5 M MN1ɺC 1LO H5L iI^HD$pf/)$HHD$)$:HHPH\Z9HDE1H'HHT$ IHuLTAH5H9uᾂLDd$H\$/T$A$4fDAf.A4A4~AE;oH :U9Ht$H@LHL1hHHH0D9hH9uE4EM 1fI0A;4E9,$uID$1A4~D$I*E1AH0E;4D9+uHC2bVA~fDIVH=q HN H=h|HDDAtDAHDADA=uDAGeDAUDA|EDAg5DA%DADADAfDDLH 6H{ HJfDD$HDd$xMt9D$&DT$@ED$8Dd$\fo$fo$D$XD$@)$D$`D$D)$D$dD$D$H,@DLH I|$ HI0A;4DA4~z$ID$1DLH$HH9$.XfHC1DLHD$0jHH9D$0MvD$EaD$@|$8QHcD$8D@D$88f.z!MU1ۉl$0$ALD$D$.D$D$}DA4AH0A9}DDL5u$AA4l$0\$D@HuHH=2' HB1ҾHHt/HDH1ҾHHt/HH1ҾHbHt/HH1ҾH8H/H¼H@IcHi5H 34IF(1H-E xfDIF(94~cHcLHRHLcX+DSt1EI1ɺQ H5A \KdHIF8IF(94D$|LAFTHD$pIFXt'LH 8LHݏ=LuAL#;L9nAhIF @@BdLVLAo(Ao8AoHAoXAohAoxAoA AIF(PAAwAAA AAAA A%LxrL#%LAO)ALALAdLAtAdžIdžIF @ tA tAA#L 1A5LA 1AևLA AIF PЉA? #AA@ AA}LtANLȿtA1ҾL|Ht"HƹH= uA?1ҾMf@LA?{|LHHHHDM HھLLH% H= HLP 1ɺ 1A@H5= )LɾrLA A蜾LA AoLA 1A袅1҅ AL 1A%{H H=| H€t"H;XHH€I#L軽tO1Ҿ#LHH8GHK0I>HxIHEML)6"LLtIHt 8I^@AI9JL=E-LHHt HL7HL9Hk"HþtH1Ҿ"HHtHǾ,諵I~HuHL藒uLLR 17 H5"; 蟿LA]1ɺ 1H5: r轕L腍LctLkdL[L]HHZL]L]ILHǀI d MNL=> 11 H5>: 軾LAo(Ao8AoHAoXAohAAoxAoAAAAAA\L3I~qG$7L$Lt$Dȃ!9L$TD$9ND$TD$PAOĉD$PA`}DA4Y1I A uCIcHHi5H@HHH=3D HX H9H0zЂtfDD$DDd$PD$LD$D$TfDA RL軹t AdžL蟹t:Hk LI1ɺHQIH# LTtAUL;t AdžL:L LvL\LҸBgL踸(|L螸L脸GLj=LPL6IFH= H€|HƹH=zlLA H$LÅ $MN1ɺ L9 H5!6 1蜺'1L9 AH55 1s IL  L9 HH55 LE11=1H55 1Lc9 L߶ <Lʶ L赶 L蠶ZAtIF @i -LsPLA AJIN LA ЉAA@E1AxŃ    1ۃ }LȵAdLA фADD薵EA IF @@ 1Ҿ&L|'LA 1AIrIH HwOHƹH" HgC MHǹL AH1ɺ PLwI 1H5_3 Y1^L%PsH) IF @@. IF(HH HT$pLt$|H QALCIF @@1ҾL{LCLAIF @@L{LT1ɺu H5m2 DL裳H=c H~ H=HzA|f1H54 H=4 諬fDH L|HD$(tLTLHTIH Hǂ!LLS1ɺ H5Y1 ۵LuS1ɺ H5+1 譵yLDB 6 H51 聵AIF(LG H50 L1C^LR1ɺ H50 Hݱ[HȱFH=x DH1fDI~aLcR1ɺ 1H50 虴eLA  H5/ m"L+-0AH%LڿALAu H= HLB 1 H5V/ ӳ6OL葰OLÅL$`9L$@L$d9L$DDHJItDL$HE=t$X:Hc\$\Hv<9Hi54<HHcH IHHH H<9(Hi5H,<9H %<9HL,5H$H$L$HIl$XfDAE8txI}uqI}ujAU4tIuE11LtMAE8IuMLL}$t A}0 D$EtA}0 I@;5mH$Hi5H21ɺCLKL? H5p- PD$dP1I~HSH3AXAYHL0 1& H5(- 襱LIO1ɺ H5, 聱H IH= H€KIL8@ 11 H5, &I"LN1ɺ 1H5|, Hi5H :914t&JHcH IHHH599*HL$L M…HL$HAHTHH9LMu\LN1ɺq gLw? ) H5+ 1@<LI~1҉LM1ɺ 1H5f+ lLg? 1ɺ 1H5@+ 软1ɺ_ Mf@LQMH5+ 萯L.NHtH!KL= 1g H5* HsLL1ɺn H5* JH=OtLH-: LH€L@ 1ɺ 1H5<* 蹮IAL EADL蝔LL1ɺ H5) QAL> 11 H5) 1&AL"> 1ɺ 1H5{) AL> 11 H5W) 1ҭHDIL+; H5) 1薭IF(1ҾLqIF(xlXAPLg7L{V7H=, zHHy44L4e5>L > 1ɺ 1H5R( Ϭ%P(0L< 12 H5( 蜬L@J1ɺ H5' sLN+ I H5' LMNL< 11۹ H5' L$XH$H$QL,DDӪUAWI1L*9 H5L' ɫZHYL9%HD LL=G D貭HHuH-: IAtA1ɺ 1L; H5& O@L9 1 H5& &LL$ L7 1gH5{& DD$E|$THL7 11mH5;& 轪Hc|$PHi511H=84H=* Ht]H111IF(11LÅLG1ɺ 1H5% .H=Ǚ 111IF(_W1L; 1ɺ H5g% IF(-LZ( 11jH58% 躩Hc|$7LHH ̫H5( HH蚝Ht)Lf; 1ɺ 1H5$ dAH5( H]Ht)LQ; 1ɺ 1H5$ 'AH5y( H HL8; 1ɺ 1H5i$ AAIF(H$LcfH519IL$)$Hi5H)$)$)$H)$T )$ )$0)$@Hi5LIH5e19HHA@LL$HHH-2LUH,Dm EASML5 AWH5K# 1ƧIF([]H$HcfLHHH509H$Hi5HA@H)$)$ HH)$0TH,)$@IL% }ML4 fLXD$D$D$D$LA@LHHLH,TR`L}IFaH= --b@S贰D؉[DAWIAVE1AUIATAUHSHfA]莘HfIA]HDA u#'tn"ti1IELu8tHHt uDA tAFANl:t2Mc7LjE9aHD[]A\A]A^A_IAE9~IcHDDAWAVAUATUSH8H<$HHt$H52 dH%(H$(1ĞH3IE1Ld$ H$ fDEu$ #$!!Hڋ H!%tDHJHDщ@HH)Hu$ @LLH@ADD$AEtdHT$ H=# HtbH=# HtHH<$LDŃAǃ"Ll$LHUH@Lu,H$(dH3%(TH8[]A\A]A^A_Ð8TLL$H HALAH5 A9HDHPHvP1RfH rfDVfDƄ$RIٹLk" LH5N 1ĢfD1Lj5 ^H5 |A1L{5 _H5 UƄ$RIٹL4 FSjf.ATAU1S EA11HHtTH5g6H8yu H[]A\DH1Lg?11H5  蝡LA?1ɺ1H5 wDSH1H=*9H8'8H88kH[mff.fAWAVAUATUSHXdH%(HD$H1HH.AI/HϓH= HHPHEHÀۅt; H=E HÀۅt H=2 H1ۄþ1A蔕uږE18 A11ru踖8 I1Ku葖8 1'tJLt$$H= LHL$HdH3 %(WHX[]A\A]A^A_fD#8 IuH59H=N HHi2HHuA}PH5V H1H5, H= H2HHEH= e:H5^9H= 轘H2HHE H= %IvH= ؓIvH= CljD$ H= HD$ǔH=H2 HD$螐IHuA1Hx L诙HuLBzL4Et H= H؃AƒvnMD$H=;L€H= L€H K IL$A]UIt$H= =111 HHXLe0I\$AMl$HHHHHZLDHÃ1Lz/ H5  茜Aٹ1L/ H5 eMLD$HD$OT$9;T$$;T$(;T$,LL$LD$HL$ t$D苒8IŃ-؏HL / PHL PHxH5. P1訛H f.8tLn1PHL O/ PH5 1S_AXAIt$H= €H  IL$D111HH#L`0I<$MqHfHt$0yHD$0ADD9l$$t+D9l$(t$D9l$,tLD$L$ HDt$cHD$0AA9|F1Hvt*轌H赝tH5Z8H"7 fDH>H ID$H= L€NH=F L€/A8-11L, H5 tf.1H膽6ɋIuH lfDA}HL i PHo L PHuH5m P1H fDH=; <H=5 HHH= ێLH= $Ń(H= m8IL  L?RH5 PH PHuP1H BD1LDS6A>ߋH5 H1詇L@+ 1H5. 諗18芋L  LVH5 PH PHWtP1_H 葎܍85L  L)QH5 PH PHtP1 H fAWAVAUAATUSHHdH%(H$1Ld$`Hl$pL] HU H%H[3H.H~HHHLLq H߉W/HH' HڒRHD$\L= , DŽ$;LM9H,$DM$$M9Mt$Mt1L/EtLS1ɺMIH5* 1s1LHHHuLgLHH1ɺUIL+ H5* 1M$$]A^M9\H,$H$1HmHT$\HH߹D$ &D|$\E:LM9tfDI|$Ht0M$$M9u辆H[EuH HV9L*+ 1ɺIH5) 15H1ҾH LH^IH LA L H4@H$dH3 %(Do H[]A\A]A^A_@HHHHԏyH?4 HL?( H5( 跒2fHsH^&1ҾH觔L 01ɺIH1HH HH ?81HA H1HH߀H1Ҿ!H+E1HHHHH u8Lx/1ɺCH5' 1讑fEA @HH= L' 1ɺH5& GfLqH5& 1ALQ& 1H5X& gHx rL& H5& A訐#L$H5% AxHHiH#fƄ$)$)$*61ҾHKH$HK&H$Hfo$fo$HHD$)$)$HCH{@2HHL$HLfoXfoih(),$4H$HH$11臥IHHLH-IHLHHuH{HtLpH<$H@L,1ɺ1H5S$ fL& 1H5($ 輎L% 1ɺ1H5$ 薎HT^HI9H$H- L,$HD$L{0Ls(ILc CMLDMLDMLDfH{IHtƤIHL' 11t$H5A# AWAVATAUҍH0HH9$*f)$)$)$)$DKEHH|$L}# @1?!IBH_HIH1ɺ:ATI1L}$ H5" AZA[ HLd$pI9u>@M$$I9-1Ҿ!HIt$E1HHHZuL_*1ɺqH5! 藌vL811L*$ H5! iL<$H$L2IH;$uDIMLM9t&IH1HRHHuLNH$IL(H;$<HL$\Hl$@HHL$H\$HLd$ fDIELML;,$IIHt$;;tDL$\EtH\$`IGHL$ L#HD$(H9HHl$0MHL|$8IIIMLI9IHLH茂uHl$0ML|$8HcL[H|$@HIšH1PL IٺSH5E 1܊_AXH|$ _H\$HLd$ Hl$@Ll$`L5" M9t4MMM1cH5 |MmM9u1LJ" 1ɺlH5 RHD$pL8IH9u$f.IMLI9IL`H1HHLPH1LHHuL[LI臠AV1L! Pt1M$H5 蛉YL^lH|$(%Hx4L _IH5 1M,L&1ɺAH5 A#HHcIHeIL 1H5N Lu YH5" 軈H^LO&1ɺt1H5 腈dMLN 'H5 AUM1L H5 A#f1ҾH)$)$Ƅ$#H$H#fo$H$HHHD$)$fo$)$HHHHt$HpH'Hu(HtV>.tQ1H/HtBE1E111HHEqt)HăuHu(H= H52E11jALfHjoH []A\fDL H5P >|AUIATIUHSHHYDHsEH-HHH@XH"H!L dHx1HHLL/HSHL5 L + H- LkH[IDAT1Lo AUIaU@H5_ 1S1:{H H[]A\A]f11HdH+HSH-v6H-v6Hrw6Hv6&fDL ԫ L: 91H5 zH[]A\A]DLI1ɺYH5 zH[]A\A]ÐL1ɺ\H5n QzHLK1AT2H56 L? z^_fDLMH?L{ fDHLKEATL H5 yZY{AWfAVAUATIUSHH8dH%(HD$(1)D$HD$ F%H*HZHIL/HnHt&HLΖIHtHLKp{H/kH߾/HPHHEkHHPHEڀ}-E1<-+LA}jHI)jL9;L HHHHoI|$HD|$HD$HI|$H߫HD$ H1LHHkHD$HE1LHCH11PALSjHLD$,H D$ RfHU<-HAfDL 1H5w UwHL$(dH3 %(H8[]A\A]A^A_DL DH31FHk/H[IHlHHL蚔IHLHnHMAVL @H]AHfDLq 1H5~ \v@fDL1ɺH5F )vL H5 u@HIٹAVL6 1H5 uXZ_L H5 u,@HMAVL6 @IٹL! H5U 3udl@AUIHATUHSHHYHs,HIċHu3HtNHLGtnH[]A\A]fHKI}AH8HHu1L21H5 otH[]A\A]DL1ɿH5N 9tH[]A\A]HLK1L4 H5 sXZfAWAVAUI1ATA USHHdH%(H$1HHHHrH߉D$H5 _i[]A\DH(dH%(HD$1 HD$H$u HD$HH`HD$dH3%(uH(1`AWIAVAUIATIUSLHAA@I@(HMLLPH2H8dtPLLL褢IH`HC(H@Ht E1LLL$LLLЉŅAH[]A\A]A^A_D;H*LC(HLLLAPŅuL1ɺM1H5 gDLy1ɺV1H5 gtf.LLLLPŅLL01ɺf1H56 fg+1LR jH5 HE HtIFXt/IL$LL$ILLLtD$uE@HH;$ufH<$'IH苏fDL 15H5 '^fL\ ZH5 ]a4U@AUATUSHdH%(HD$1$D$FYHI1HDMLD$IHEd~tp<$tjH[DELÉEx/M1PL׾ 1H5 uA]XZ<$u71'1Lz %H5 \1Ht$dH34%(uWH[]A\A]CxHmIAT1H5 UML/ @Ǻ,11\Y^TSff.AWIAVAUATIUHSH8ZdH%(HD$(1D$D$ D$$uXQH1ɺL DRHkHu1MH LbD$EWELt$ Hu1LMHg$AŅ)HHu1jDD$0LLL$4vMAXAYHH&HuHIHH}IW HtHHT$RHT$Ht IUXLHMLLL$MHLAŅcH'LWHOHfLi1ɺH5l Z@IW LmH L跽1LZ MH5# @H11AUAAZZYHsxH1ɺLBHiHu1MH L]L1ɺH5 Y1ҾLLA?1Ou>LfL)1ɺH5, aY@L1ɺ1H5 E14YLM1L H5 YH\$(dH3%(DCH8[]A\A]A^A_fDD\$EDA1ML H5g A@11XGfDLM1L) H5( XXGD$$H]4{1IٺL H5 A@11 XfDLm71L MH5 A@11WHL+EH}kfDL91ɺ1H5? oW+f.L 1ɺ1H5 ?WPf.L1ɺH5 WHIE1PH5 1L V^_L1ɺH5 VMff.fAWAAVMAUIATIULSHHdH%(H$1,S1ҾH߉D$XD|$\e1ҾHAH߉d1ALt$h‰D$PT$TLl$pLd$xLd$PLMl$0LD$d1HMt&LGHQHPLLFز0Hd$p t$\E11H߾y HHLHHA1zD$\HH߅t EnH$dH3 %(DH[]A\A]A^A_fT$XAHH L LEH1ɺPL& H5u 1TD$`A^A_1H~hE1D$dADl$XD$(EtD$PH LHHtkD\$\EMLl$(;fDDT$(E2DL$XEuLHH:t&|$P1LLH-ufADL 1H5\ SL51ɺ1H5; AeSBL 1H5 II~HT$H謳t DD$,EtLMMpHD$0I$I9u‹81ImHmHt$Ht H{"Ht$HA/f.ADLi1ɺhH5l AQ\fDIvHHHD$0L$P1HJHHL`L5L% f.|$PD$`H11AVAE11UHjH LH>T$`uA1ҾHQD$PTL 1pH5\ APGLl 9H5) ^PG蟩DPAAWAVAUIATUHSHHHLqdH%(H$1cf1ҾH)D$I)D$ D$0~[1ҾCH߉D$ k[H߉D$LHAzLAFAMtH8EHOH$L$taHDD$ HE ML 11lH5= NH$HTEt1HKHK$CHiKMtLTct$H H+KE111MLC H5n ,NMtH1HHMtQo]oeLl$I|$0)\$)d$ ?LDID$0H4Hl4H,1ML?C H5 @11Ƀ}MAH$dH3%(HĘ[]A\A]A^A_EtIEH@@XqHILdMB1L H5' LH5XHA;Lr1ɺyH5 L,HcI3 $-軯1ML H5 @11ɃQLHE`@X HLH8LN AWZ1fLXpI}1Ҿ4 XHHCL 14H5 KQf.H#H)M1PLH5 cKM1LZ QH5y MY^D\$ UHSHH_1HE11H0LI HHVu6RՀ4v< uKEt=u9"f.Is"f.uAHI9u1H[]<{uEttDEAWAVAUATUSHH $HH $HH|$HHHt$HT$8HL$@dH%(H$x 1t$P5HD$0HHl$p1HD$lILt$oHD$ AL;L$fDL1AHDBD;DC>< IIuHAHt$ LLL$L$EL$LL$AL;L$t1ۃ|$PHD$@{H8HD$8H|$0H8H$x dH3<%( HĈ []A\A]A^A_ÐHcEBL=HÃ~IZDl$TDLELL$XAAAztUH|$0zH$pEIDHD$f.DH;D$1HHH|$HAHcHT ttHH=uܹDt$pEkHcAIč;D$PALl$0Ll$/IHT5E1\$ D1DL$,HM1fDA HcŃDpL9t&EwIEtA tuA uL9uHc͋\$ DL$,LDqHL$Ht$H H|$IcDDL$ 6DL$ H|$0,L1ɺ 1H5, :1DH|$0HHTHTAGH>fD#LK0H EDHD$ (D$TAݍC9D$P[D$TtwHT$XHt$HDH|$025&H|$03,L1ɺ 2L1ɺ UH|$0TTTH|$0fTrD0DAUATUHHSHHu[HtFH1HMċ;IQ2H9u,;LL)HxI9H[]A\A]fH1[]A\A]HHL[]A\A]ff.AWIAVAUATUSH(H|$xHL$HLD$`LL$PdH%(H$1HH5M HH2HD$XHHD$`fE1HDŽ$)$H-)$H D$lHD$H$H$H$D$hDŽ$DŽ$HD$p@HD$HLI9EIcH;D$~L$1fL)$HH$)$HD$ HDŽ$DŽ$DŽ$|$hEl$EEA EAGhZHD$PH<$H$N01HfDADڈD< HHuH<$H$LL$@LD$8DT$0D\$(BD\$(DT$0LD$8LL$@H4$LϹLHc$DT$8D\$0LD$((H<$D\$0I1DT$8LD$(HfDDшD< ]UHHuH4$H= :H<$Ht$ HoOO&G*o_N fF$1))^H) $H<$HHHt$p< tt HHH9uH4$DT$8H= LD$0LL$(H<$H$D\$@H5((D\$@~AGtLL$(LD$0DT$8t$A9G8WD$h$HT$`ADL9A8wLHt$P<HH9wL)HL$(=v0Ht$P|HHPH9uHD$HL 1ɺ7H5A D\$ M 14D\$ HciD$h t$lu`H|$Xt H|$Xv0H|$X,ulH$dH34%([H([]A\A]A^A_fHcL 1ɺ1H5 4zHD$XHL1ɺ1H5T 3nL1ɺ1H5. 3:IٹL$ H5 31!HD$(QHD$0L)HD$(H|HiD\$@HL$L$D$HL$8)+D\$@HH$HD$(HL$8D$L$HL$HLHHDT$@L$H$D\$8-HD$(HT$0HHHD$PH-D\$8DT$@H$L$< D$(u| u1| D$($H$fo$fo$H$)$)$H޿ϦD\$0LL$@DT$8lLt$HH1t$($L H5G RLL$XIAQMP1U1H0HHߋ$DT$8H$HDŽ$DED$ZD\$0D\$ M1ɺWL H5 V1D\$ D$(0H|$xD\$ .D\$ t'H5 HD\$($%D\$(HHD$ H|$Xt2$Dp|Ht$XHD\$ %D$D\$ HD\$ "HD\$ yHH ADEDEZH$\D\$ !Ht$ H$H$H3VH3H u/H$H$H3VH3FH uHF H9$D$lML 11YD\$ H5X /D\$ 1D\$ HI1AV1ɺL H5" /ZYD\$ HLHLL$@HL$8DT$0D\$(*LL$@HL$8DT$0D\$(HL$XH= D\$ :)D\$ ZHL$(H-HD$0HL5qI`1LHHt$ B0 tt HH=u޾ LD\$($D\$(Ht11MbLD\$(H5 .H|$ H5P "D\$(HH1LHB0 tt HH=u LD\$ $D\$ HtMLB 11iD\$ H5 .D\$ HD$0HL$(4%@SHHdH%(HD$1HH$u4H$H HH%H)Hv?HL$dH3 %(uTH[ÐL91ɺL1H5 o-D1L1ɺRH5 G-1~$ff.SHHdH%(HD$1HH$u4H$H HH%H)Hv?HL$dH3 %(uTH[ÐLy1ɺ71H5 ,D1LO1ɺ=H5 ,1#ff.AWILAVIAUAATIԺULSLH(LL$Hl$HdH%(H$1LL$HHufoHD$IGϦD$HD$@AGLL$0D$$H\$(HD$8D$HD$LHD$PHD$XHD$`XfH1ɺ D$AGLL AUH5 P1Aw]+H11AU IH5 L 3+XZL'L'u&LAH= H1Ru1nIOIWHLHHL¸uNLy  1H5 *1&1L? 1ɺ H5 _*H$dH3%(u]H([]A\A]A^A_DH1H5 ES L6 *Y1^L  S%!DLVM9wbfH1IL HH5 HR AQM)1Hf.AWAVAUATUHSHH]!H<Iƹ 1HHLkE1L% fDIcDLLH1H\"AI9uAoAoNLAoV Ao^0Aof@AonP)EAov`Ao~p)M)U AoAo)]0AoAo)e@Ao)mPAo)u`Ao)}pAo))))))))MHH[]A\A]A^A_L  1ɺl1L H5a 'ff.AWAAVAUATU1SHxH|$0H$L$`Ht$8H$H$L$D$L$MLL$L$H|$ Ht$(LHD$dH%(H$h1AI@D$HHD$PHD$XrEIt$Ϧ1a;$`H5A%r0N*>I3T$ H LVM2 x[H3$dH $H|$D$$tt0HL A1j1H5 &_AXL;$xt/H1H5 AAULt 1H&Y^H$H9$H11ɺ$ALw H5o %XZ|$HD$$D$H1ADHIM(It$(HD$XHD$`HD$PPHD$hPHD$hPL$HIM@AD$PIt$@DAjjjL$H Lt$PMX|$EH$HHHt$(H|$ ILH$:jHT$Ht$8ILL$H|$0H1H$`H= HA1PL0 1H5 `$AYAZD$fHAL 1PH5 1'$A[[,f.$-1H|$LUH$HHHt$(H|$ ILH$H|$H5 bIHH$LHHWHt?Hi1$LL$ L) H5 -#A]A^$H:LLB,$؃DD$HD$LD$HD$XHxH$^IHbH$KT5HT$LH9$D$Ht$(MH|$ E)LLT$0LT$0H$IHt$(OH|$ HT$8D$0+$F,0L|DL$0HAL 1AUt$Ht$AVjH5\ !H0L1H$hdH3%(cHx[]A\A]A^A_D|$MW1fDHAL 1AUH5 1N!A1ɺ$pLe H5 $1 !XZI|$Ht$`HA1PLI 1H5W  A1ɺ$L2 H5) $1 Y$AL# 1ɺ1H5  ^$AL 11H5 ` _AXGM1ɺ Lj H5 . 1QLɽ1ɺX1H5p 1"HML 1$\H54 HZY@L,$HT$MHt$(H|$ LkEH$DLϦE1M4A(ZD$ 9D$t3jL 1ɺULL$H5 1A/AYAZ11mD |$HHLLHHUH L2MtLH$H$IHzHtHT$LH5+ dH茼ELLH1EHML 1$[L1ɺW1H5 /f.Lɻ1ɺr1H5p f.L1ɺp1H5@ f.LL$1L( bH5 H1Ly 1ɺ1H5 A[EkD$LH1ɺL H5 PH PD$8PLL$(1H D$1H|$H|$H5d IHILHLLLY1ɺ1H5 f.HAL 1ARt$t$AVj\H1ɿt$LL$L` AH5 _HAXE%1LԮ1H5P L7 L11H5' D$LMLH1ɺPH5 L AVD$8PLL$(1oH t$[f.4$ALk 1jH5 1'A[[GHALa 1t$1AVH5] jH L H趸EtmD$L1L5V La1ɺ1H5 LL$L 1H5 iE1AT1 AUHHSHH EL$1Ҿ?HLDH8LBDG@DΈ HJI9uH[]A\@AWAVAUA͹ATMUHHHSHH HxH$LL$8HD$H$HD$H$HD$H$HD$0dH%(H$h1H$`HT$ IH$ E1AHLABELONEH9$`.H;$hH$ϦHpS;$pL$t HLVM2 001H9$xMt EtA$ESH$H|$@Hp D$,U\$,H$HD$ HXH H$1L%) LpHIHD}I>DEtHAM1SMH5 1YA6AL 1ɺO1H5f ^AvL A11QH58 _AXd@EHMfHH+D$ H$I9t$AL 11iH5 wE1I~9Lt$8tfHL$IHIHHt:H=t2HH5 A1PL 1^_IHAI<$Eu)I$ID$EwH|$HL$HHDHALr 1SnH5 1AXA4$AL 1ɺp1H5޿ mAYAt$AL| 1ɺr1H5 BAZA[PfHD$0Mt$D8EH4$HH+D$ HDI9t!LM 1ɺ1H5T HI|$Il$AL51 HAHH}EtHEM1SH5 1w_uEL 1ɺ1H5 OAXuEL 1ɺ1H5 &AYAZeDEH$hdH34%(D$,Hx[]A\A]A^A_fL! 1ɺ1H50 A11L H5 $t fAL^ 11H5 I$@L 1ɺH5 !@HEL 1SH5b 1XuEL 1ɺ1H58 Zu1E1H5 L Y^HAL 1SH5ڼ 1gA[A4$ALO 1ɺ1H5 =A_At$A1ɺ1L> H5~ HkHH+D$0HD$ZYI9t!LC 1ɺ1H5J I11L H5& EL$11L H5 EL$11LT H5ջ i@HD$ L 1ɺ5H5 LH 16H$Ht$`H Hx 1L 6IH5g 1L 11L$7H57 fDHEL 1S[H5 1A\A6EL 1ɺ]1H5ߺ nXAv_1ELx 1H5 EXZfDL 1ɺ1L H5w JfDL L 1ɺ1L H5I E1LL$ Lj 11H\$`H5 L<$HH R L21LL IH5ѹ 1^11L9 L$hH5 511L) D$pH5x L 11D$tH5O IHH  {L 1ɺIH5 1TfLL$ L4 1ɺH5 |D$,`H$E1LpHff.AWIAVE1AUMATIUHSHHXDL$ dH%(HD$H1D$$HD$(HD$0HD$8HD$@ DU\EHD$$DT$1E1PLLLHD$HPHD$HPHD$HPLL$HH L$$E1ۅDT$AÅAAt5E(HL$HdH3 %(HX[]A\A]A^A_@HD$8HL 1ɺH5g fD1ҾHIH1낐`H HD$$LE11PLLHD$HPHD$HPHD$HPLL$HH T$$E1ۅAD\$jHD$$Pt$@t$@AU1MHATD$HߋL$<]H0D\$1L H5y  1D\$jHT$(Rt$PP@1LѸ 1ɺH58  nD`HFAfAWAVAUATUSH8dH%(HD$(1H:HD$HD$HD$HD$ $D$uHD$Dv\MIPHHI11LHD$(PHD$(PHD$(PLL$(LD$ \$ H T\$Eh<L 1< H5  L~ 1= H5  HT$(dH3%(!H8[]A\A]A^A_AtAtLAJLD$MZLL$LLL2Åtf.LD$1MpLL$ LLL FfDLq 1ۺ( H5  1L 0 H5ݳ l LE 11 H5 H H}lH}aL3 1ɺ7 1H5z  LD$MLD$M1DL 1B H5  C L{ H5 11 Lе 1H H5Ͳ \ I L+ LL$LLLLÅ8LD$Mf.AWfAVAUIATUHSLHhH|$H$LHL$H dH%(H$X1)$)$Ƅ$HD$XHD$`HD$hHD$pHD$xHDŽ$D$PD$THL$[cH$11HH HD$ HD$PPH$PH$PH$PH|$0L$LD$tH L$TD|$PEu_HD$`H D$pEh<J1H5 1Ls H|$ D$PEl?HD$pHt LML9 HD$xLM Ht L9 HELL$xD$PHD$pL$PHt$HLn EtIU < H H$fMuM}It$ H)$)$Ƅ$)$)$Ƅ$)$ )$0Ƅ$@HDŽ$HD$8谐D$(f)$)$EtF D$0fDupEfDHL 1ɺIH5_ 1L9 1ɺH5- y@fo$fo$)$ )$0EtD$(D$0LH$L9ADž H|$H$|?H$HD$ Hf HD$ DT$0LEHD$ HI9H$ f.LxIIOH3H3OH eIWIOH3WH3OH LAoIH|$ M)$Ao_II )$bH$H|$HT$XHADž- H|$XHt H9HLABELONEI fo$fo$H$PHLVM2 001H$hHD$DŽ$d H$XD$P)$pA)|$0L$L$HDŽ$HDŽ$HDŽ$bHD$`IHT$hHDŽ$H$ HD$pxH$HD$xH$HϦHHHDŽxHDŽID H0It$H@H@=1Le $`A1AVH5= U^_t$xt$x1H5$ 1t$xML` t$x H H|$WH|$u HE1!H=ޮ H1LI3T$ H LVM2 x[H3$TH !H|$ BHt$ HH%H-H)HD$(HHt$09IH!HT$0Ht$(HHثH5A%r0N*>I3V H LVM2 x[I3FH sA~AHD$(I;FZHD$0H %H LIuLt$8LD|$LIH\$@IHf.HL9ooLLo o0o@op)$PooP)$`o`)$po)$o)$o)$o)$o)$o)$o)$)$)$)$)$ )$0)$@HLt$8H\$@H1Ld$8uL 1H5 ATL|$8MLL$L$D$`XZLM9t-@HM}HIHtMmM9uH|$ EtDL$(EUDD$0EWL H5F 1E1oMu   HH= g HH=џ H=.u H H= H H= H' H=} HQ H=t HH=` HM-LHtDL H!%tDHJHDщHL)H IHD$d1PH$PH$PH$PHT$hHt$(H|$8L$L$z$hH  L$AM¨ D$<EkLJ 1?H5n L 1*H5= L $Ll H5 -L>1ɺ H5 vslL1ɿH5 RHT$U1ҾiHaHR H=e H€ H=ae H€Hƹ H=y LD$HL$LHH$RLI1ɺY cDH$H HILF P +fDL $ 1L, H5 0L$L 1 H5m HE1jnfL1ɺhH52 1HT$HD$H@H|$^HLf P LL$KfDL$L 1 H5 LIL1ɺ 1H5 +f.HPH$H$L$H$A<$#AHc= KI$HIDP t)IT$DP tH5rxLHt@A# A|,u A|, Lk 1ɺc 1H5 AHt$xLT H5 L-H)oXHH$o`$@&$A$f$$H$ϦH$$H$H$H$H$HHIٺ PLP 1H5э `XZGfL$L 1 H5 $!L1ɺ DHD$hE1D$hHD$pHD$xHDŽ$HDŽ$PH$PH$PH$PHT$hHt$(H|$8L$H DD$hEZ j1@LE1E11HHD$hP$$t$ht$0YH0; H$Ht|jE1E11LHHT$lR$Pt$ht$0 H0D$`t8T$dt09t,LC 1ɺ1H5 SL* 1H5 }@HD$dH|$11HD$pHD$xIHDŽ$I HDŽ$D$hPH$PH$PH$PHt$(L$L$H |$huCH|$1H5; ILM 1H< H$H|$LH HuϦHLABELONEH$HLVM2 001H$HD$DŽ$ H$1H5 A$1L* HX Hsu#H|$H=R H1$+ H%[T$<LHD$pLl$1D$(H$HD$\L$HD$HD$hHD$ L|$ILL IH5 1)D$(H9l$<@HD$HHL$LIHHD$p11LHD$xLHDŽ$HDŽ$D$TD$XD$\D$`D$dD$ht$ AVH$PH$PLL$ LD$(tH T$\E1HD$pAH6H$HjLH1ɺAUI1LK H5k AZA[D|$`E3|$dE1ҾHIHL\{1ɺ 1H5 U H=[ L€LH$H$HHDŽ$HDŽ$ L KH$L$HLz1ɺ 1H5f H1H5J 1$L$L1 Y^HL 11$L$H5 AXAYfo$$Tfo$$$,LɮHMPH5 z 1L  Y^L 1C H5S D$PE1E1HT$dE1E11RHHT$`R1$PjAWHt$H賳H0D$\AP1E1,L$D$<M!E2M ALL$hHD$pM9MHLܟ 1ɺP1H5b XZHML1 1ATH58 1LA[IXMHt$HH|$MLLQHMMLLH߽MLNH|$LD $D $IAOLL$xH$M9&MHL$ 1ɺPHT$`E1E11RHHT$\R1$PjAWHt$HH0D$\Ad@ H= L$L [ H5 xLQ 1\ H5ł T@H$cLv11 H5 ".L 1ɺ{1H5m H$H8@I 1LL H5" t1H5 1L% n HH=G "#3L6 1 H5 1LILs1ɺ1H5t Ls1ɺqL7 g H55 tI 1LM H5 /LY 1ɺ1H5~ w$LD$LHH$HL$HKLD$HL$HLHLr1ɺf H5p~ EA=A1L H5'~ ~EAArL$MfH|$LD $臦MD $IuH|$L.AIƋ$P $LL 1ɺU1H5} D $D $EMM-E1H= ?lHyH$HD$`gfH~fDLL$(1L= OH5~ DLHV1t$0LL$@L H56 oXZL g1ɺH5 ALf1ɺH5Ӑ _1L! H5 * f.AVAUATUHHSHMHI OH߅P MIľHKcHMHNugHu61HHH\[]A\A]A^fH[]A\A]A^f.LHI+1-ML H5c @H11ATXZOfDHNI*1M)H5 Lf @H11AV`YH^MYfLHALHALE)LLHHM1PL 1#H5 _AX[]A\A]A^H[]A\A]A^fATIUSHftjHUu&HDuH3LHA D1H5 7[]A\DH;H& HMHHqHHmHXHCt&H2WL H tHuxHtH1LE1AH0HPjcZY@L? RxfLH[]A\L \Qf.AVIAUIATIULSHFPHH?H6IHtVHsHI<$!IEHt@oEoKMoS U o[0]0HC@[HE@]A\A]A^1L SH5 [1]A\A]A^fAUIATIUHHSHHYC@G LHHtALC HS(HK0HH}t C8H[]A\A]LGH&1IL}d H5ϒ @11ɃC8H[]A\A]ff.fL`1ɺ&1H5 ff.@AWIAVAUATUHSH(LqH|$HH4$dH%(H$1FI^IHIFH@H@ @Ht$ LFILAD$Y@ *lD\$,HEHHD$PHt$Pa LL$H|$LLA AHD$ L3c E;tJIL$X@LH1ɺEP1H5 L E)1Y^HmL9LeM9tHI|$HHLMLxHIH(xI0uL藳HuL[V1ɺ-H5A 蓸ffD.ZfDH`HW HÅLՒHL:ÅhLuw 1ɺm1H5Ww H7Åm1ɿ1tLv H5w L~L$Z&DLiB1ɺb1H5v 蟤HT$(dH3%(H0[]A\A]A^@L!B1ɺB1H5v WLxu 1]H5kv 3뒐H(H8MD$ @Lu 11ۺwH5v >DH`Lu iIH5u 1詣@L1u 1oH5u |貚fAUATUSHHdH%(H$81 IHIՉL"H߀$0謟H߉D$蛟H5H߉l$D$L,$u*|$Lbu 1ɺ)H5xu ¢H{H-|$1HIHHHLaLH߃H$8dH3 %(HH[]A\A]fDLt H5t L?1ɺ+1H5t xD-@L 18H5_t 蟡5f.L9?1ɺ1H5't l袘fAUATUSHHYHC HHII'uDHH LLAHDCH[]A\A]H5HIuL~>1ɺ.H5t 趠1LZs "H5s 脠H[]A\A]@L>1ɺ2H5s QH[]A\A]ÐAVAUATUSHH dH%(HD$1AIվW1裯1ҾWHKHHD$H$.1HHHHE11DHEALHH>PU=Dt$Dd$AXZE)1EH5r ^@H11ATLer PY^HHDHL$dH3 %(H []A\A]A^Lq 1@H5[r A@L!f 11FH5)r A輞iL 1TH5q A膞3輕f.fAWAVAUATIUHSHHHYdH%(HD$81 tH#nLtH}$MCHi$aH#HAN#LLkH,"LI茚DkE7H{(S 1ًL\tNL|$(HLS&Cs MMH{(Hp H1 Ls(A2H#H!LH跹IHE`H-b HtHh8[81EcH L|p @HH57p 1ATUP1SAV輜H0HL$8dH3 %(HH[]A\A]A^A_ÃH!HCH HCHSHsL@isCI|$F4Cs cHHC(H{Dkf.{!H!HD$!HAd!t$LD)HHI!HD$8!t$LL%2a HOHHE`HtL`8HHT$"[HAWHT$1ELt R@Ǻo1ATH5n 1USAVOH0fD H HA D)LH起HI Hp LH萷HIe!HAW1EATLt hS@H5"n 1AV1謚H 1M=LKH5m @11q@L81ɺQH5m I@Lm 1WH5m _RfUSHH $HH> dH%(H$1HH$H$IHH mm HoILgm 11H5l 胙HH޿ItD1LYm 1ɺH5l K1H$dH34%(uiHĨ[]@Ll 1ɺH5vl fH11UL l Lr H5@l ӘX1ZATUSHH $HH l H= dH%(H$1HIHIH߾2x~11ɺH5k ILpl J1H߾6ǽ҆u~H$dH3 %(H[]A\fL賔tH1UL k 1LH5k 譗AYAZ+8脋 I1PH7 LjPH5j 1gXZBUL#q 1AHEk H5j P1)_AX諍H1IًH5qj 1L1k P1Y^"fAWAVAUIATI1UHSH(HL$H\$@HdH%(H$1HH蔊AƉǺHDIEBMc1LLH5-HBD<ntYILj 1ɺ1H5i 1H$dH3%(JH([]A\A]A^A_f.H߾ 裋HHxHPH=3j H H^HtH|$HsÍVf8DI1PH LhPH5h 1'XZEILri 1ɺfDILDi 1ɺf.1IL^i 1ɺH5.h 輔ff.fAUATIUHHSHHLi]tH[]A\A]H8uHUu1ɺMH5g Lh &HHuHՐt9LLh 1H5Hg ֓AET@HLHLm SA1H5g 萓XZff.AVfAUATLUSH0HdH%(HD$(1)$)D$D$ I9tMIIHHAEL9t-HCHo)MoP)UuHAL9uHD$(dH3%(u H0[]A\A]A^@AWAVAUATUSHH $HHH qg H7 LdH%(H$81Lt$0HIL&L1JAŅML1g 11H5e II$L9HL= HI9tqHC !Ho)EoH)Mf|$ DQHyG8蠅1MPH5e Le1AW艑HY^I9uD"u~H$8dH3 %(0HH[]A\A]A^A_HtH1A$L e LH5ed [1]f{8Ԅ M1PH L2dPH5&d 1跐XZBI$3Lgj AHZe SPH5c 11qAZA[HM1ɋL/e 1H5c P1.AXAY`AWAVAUATUSHH $HdH%(H$1I;HHHL-4 E1L=lAHPHHz.tLHHHHMMRH1HP_AXt8tHlI1PLbH5b 1AW1YH^跊HHgH@u,H$dH3%(uVH[]A\A]A^A_k8ĂoM1PHL"bPH5b 1觎XZޅff.AWAVAUATUSHH $H@Hn8H|$H$IL$H$HH/3 dH%(H$1D$(D$,HHH a LHD$I1蹑HI@H IHb H%A DD$A1qADžH $Ht'HcHb 1H)HAAL.HM1PD$(Lxb H5` P1AU>H 1L&ŅEufA)EIcHމ臇y~LD(H蠣1ɿL:h AUI1AVH5%` 踌AYAZ]{uH$dH3 %(H[]A\A]A^A_8HH|$ LLg SIAV1H5_ X1ZkH|$Ɉt%Ht$L _ L[}t$Le AH]_ H5_ P1蘋A[1[fDH\$01HHT$,Ht$(HHLD9l$(5H|$T$,LDt$(T$H|T$Lg AH5p^ RAVD$(P1AUt$0UH0|$0H4$HHH|$}L]SIt$Lf X!y8M~M1ɺPH L]P1H5] 0_AXH|$LLd ID$PAUH|$衆L聠H1ɺt$ID$(L,d H5] P1AU莉H DL+6HzHLd UAAVS1H5\ ?H 1@;}M1ɺPH L|\Pf.軟HzHL3c AD$ PAUS|fD胟HKz4$1ɺAD$ LVc H5[ P1AUU茈H Dt$,l$(L/HLd AVIUD$0H5[ P1AUt$86H0ID1D$9D$,H1H5n[ ED$ Lc P1Y^:蚞HbyHLd SAt$U]~f.AWAVAUATUSHH $HfLH|$LdH%(H$1)D$@)D$PD$`M9HD$pIHl$@HD$HD$D$HD$LƄ$_LAXHL$HT$Ht$ |$ptIHt$H}D$xIHD$LMfDL@HoHoIIWH3H3SH uIGIWH3CH3SH uHD$HH8ϱHfIL(] 1ɺ H1H58Q )D$0L|$0)D$@D$P}LrL@H8oHfo foSLA)A)W H!%tDHJHDщ@HL)H t,ILR 11(H5P }kLHD$KLa\ 1ɺ1H5AP |LuCs8p1ɿMPH/PLOPH5O 1|_LAXxHL1Hur87p1H5O L Q PH}PLO1|Y^sfHD$ [HL P 11UL[ wH5EO {AYAZ f.Lsu|LtLHD$(H(H$dH3<%(Hĸ[]A\A]A^A_@MLP 11|H5N D{q8oM1PHNLzNPH5nN 1zXZD{q8nL O 1L@NPjHPH5"N 1zA[[1q@AWfAVAUATIUSHHH$HL$(LD$@t$4dH%(H$1)$HDŽ$HD$` wLD$8v4LD$ v5LD$v6LD$vLD$0vD$HD$LHL(H9H$D$<HT$@HXHH]H1ɺUILN H5L 1tyA_1XHHIHHDLDvLDHt$IH@LP`IHHHHIHHHD$ .LT$ HEHLT$ E1E1H^ LLPHHuLT$ MHLHdHHIHu HCpHD$hHA$|H9|HHt 8tI$Ht8 DH0HD$(D$8tHHLNyD$ D$ D$D$ D$0D$XD$\H- L1ɺ1L|$\Lt$XLY H5J kwLLHD\$\E HHD$`Lt HL|$`IhAWLZ 1AVA1H5cJ vA_XI|$Ht$`诪I|$Ht$@HID$<u!Lj1ɺH5J vfLL$`D$ D$MDt$0ETD\$HvLlK 1ɺ<IH5I 1uIGL1PhHD$(|$81HLL羃 rH߅ HfHLV SAH5H 1 u[A^HD$HIULL;,$uO@H$dH3%(D$HHĨ[]A\A]A^A_Dt$4EIULL;,$tIDHt$hH! A$ HD$hIvHHHH=$1ҹHL.L羃pH߅T迊LJ 1ɺ\IH5OG 1sFfI9uIvHdfDkHANjT$ tH=7[HkfD eL7S +AH5F 1TsD$HL羃pH߅HdH1ɺ$SALH H5aF 1rAZA[HD$(7L羃oH߅tl臉LFH 1ɺIH5F 1rfDSL9H 1ɺ$IH5E 1or|f.HcH1ɺSALQ H5E 1*r[]yLdf 1ɺ1H5qE qDL$EAHu~EtyLn4LU 1ɺ1H5%E qE1LknHT$`H5aH 1KawfDHA  Lt$pLHLLHHLt$0lL$<H\$pL9af.H{臋L?H 1ɺIH5GD 1pHL9ufDL羃mH߅cLF 1ɺbIH5C 1pf.HHHT$`LL$`MLF 1ɺ1H5C $p L羃lH߅(軆LnF 1ɺIH5KC 1o?fL羃lH߅8sLF 1ɺrIH5C 1of.H8HaH1ɺ<UALRO H5B 1GoAXAYfDD|$<D$4H<$Y}H-a7D$<R@L羃kLH߅蔅H1ɺEAVI1H5#B LD nY^+`LQ 1ɺAH5A 1wnfLP 1ɺ1H5A OnHL$\HT$XHI|$LD$`D$<D$\fDӄH_H1ɺbSALN 1H5TA mXZH蓄H[_H1ɺASL$D HLfD$\HHT$`BLHjD|$\Lt$`H1ɺH5@ AWI1AVLO 6mY^D$<HXM$LH蹃LM 1ɺkAWI1AVH5>@ lA_LXiH߅qLB 1ɺlIH5@ 1l;H^H1ɺrASL}M cLt$`HH1AVI1L O H5? lXZ$f˂H]AVLL 1ASEf.LL$`LB 11H5,? kDkH3]H1ɺ\ASLK ;LL IH5> 1TkFL羃hH߅I\H1AVA1LaM H5m> k_AXD$ D$T$\HL|$`T$ 蛁Ic\H1ɿT$(A1L`M H5> RAWAVjH D$<L羃SgH߅3L]@ 1ɺMIH5= 1Ojf.L羃gH߅LNA 1ɺIH5s= 1if.LfyHT$`H5@ 1YfDH\$pL9f.H{'L1ɺIH5< 1siHL9ufDHsH\$pL9u>@ÃL{@ 1ɺ'IH5< 1iHL9ZH{G[t脃Lh@ 1ɺ)IH5D< 1hfDHKZH1ɺMASLH [H#ZH1SAL%L H5; 1jh_AX2LL$`Lw? 11H5;  H5*; gn~LM> 1ɺIH5: 1gLHdt&L> 1ɺ#1H5: SgXLK 1ɺ#AH5: 1%g}HXH1ɺlASLG L|XH1ɺAVA1LH H54: fD$lAYAZ]AAWfAVAUIATAUSHHXdH%(HD$H1)D$)D$ )D$0(ctHcHcbHbL = L*J H= H5b9 LD11e1HμHHHD$1LDHEE1E1HHAPUAXZL$Ht$ H,T$Ht$HH+t$ HD$T$ Ht$HDl$ID+l$DL$ID $1LI H58 @H1HL$QT$1RAVAUAWDL$0eH0HHBHL$HdH3 %(DHX[]A\A]A^A_@HafD1LH H57 @11|dzLaH 1H57 AFdOL1 1H57 AdL[ff.USHH $HH 7 H dH%(H$1HHIHsg1ɿ1ILS; %H56 cH_Tu+H$dH3%(H[]f.Y8t/W(I1PHL6PH56 1cXZfDH!1UH5X6 L 6 LͶbY^V Zff.AWAVAUATUSHH $HH $H11ɺ;LW: t$AAdH%(H$ 1D$ D$$VH55 HbXH=5 ZTHDIHl$ Lt$H$@L]HHz.tE1HHLHHRHߺL 5 L ?[LHHLHHD$(D$,A[A_Ht$D9l$gD$ 9D$Y1ɿ1ILK9 NH54 MaH%RtBW8t6 UI1ɺPPHL~4PH5r4 1aAYAZ|$ HH$IH 5 IHǾ1H d1ɿ1ML8 H54 `LmQmW8]`T1MPHH53 PL31C`Y^$@L`Yt?V8TYL 3 1PHbLj3PH5^3 1_XZH$ dH3%(uJHĸ []A\A]A^A_H1ULL {4 H53 __AXxVff.AWAVAAUIATUSHHdH%(H$1Ld$@D$0\L$1ҾHf%?f9# $A@ŅtY@tTLC 1ɺVH5G2 1A^H$dH3 %(DH[]A\A]A^A_Ð6Hc[t @1/HB[FH߉3[Dt$Hl$pH5x6 HVt\Ld6 11H51 ^@H=:6 GH=)6 Y11D$)T$}HH51 IVt\L6 11H51 ]@H=N1 ӛH==1 RY11D$赛T$yHH5l1 Ut\L5 11H50 0]@H=11 _H= 1 X11D$AT$HH51 aUt\LL5 11H5.0 \@H=1 H=q1 jX11D$͚T$l$mHl$`D$PHH=0 4H=Z0 (H=1 H$H%61ɿ1LB UH5q/ \HdLB 1ɺc1H5;/ [HqLa1ɺjIHu0*DH{ HLpHH"LHGIHuLqHD$PMHHHHD$<$AYLn1HIHL|$@HD$0IFM/M9H,$8MOL3 11,H5-. ZIEMM9IIwHH߅WWuM LH,1AWA1LB H5- PZXZ@H WFHVDD$6HVA BHD$PHl$`D$4HHD$sHkH D$8D$u HtLHH H[]A\L^@[]A\ff.ATIUHSH5>u HitLHH X H[]A\]@[]A\ff.ATIUHSH=u H tLHH  H[]A\]@[]A\ff.ATIUHSHu=u HtLHH H[]A\,]@[]A\ff.H1USHH>tVDH5 H/¸t!H5uH/u+EH[]fD@fH5"] H/tMH5H/tRH5 H{/tWH5 Hh/udu'@EH[]fDE[u˸D91ILT* -H5) >AWAVAULo@ATUSH(H_@T$ HL$LD$I9EAE1E1$Af.HL9HkHC=t߾H2=t&1ҾHIDHAă1ҾHHAu AyL$ D thA~ ApHL$IH_IcHHHPLL9LHT$HtL:H([]A\A]A^A_E11LW1ɺH52( =H(1[]A\A]A^A_E1f1(S10AЃEЉЃ@EAAff.ATIUHSHdH%(HD$1FHtluWHt$iÅI$L$9tGHL$dH3 %(H[]A\@tҋFuI$HxSL;% IH5u# 18ELi1ɺ1H5B# 8_/DF\u fUHHSHHLuZC[uTHH-# 5H߅H$ HDRH1UIL$ 1H5" 8XZH[]AVMAUIATMUSHιHdH%(H$1Hl$HHHC@[tHEAHHLH{G[t1Ht'HT$ H"D$ H{fHLHK1M@HQPtbHIE1LjUj6H H|$HHtfH$dH3 %(HĠ[]A\A]A^fM&HHJHAXH$HEHEUDLI1ɺH5! |6mL1ɺH5 L6=L1ɺH5 6 R-fLBLJ1ɺLBLJ1LBLJ11ff.LBLJDAWAAVAιAUIATMUSHHLL$Hl$ HdH%(H$1HF[tHDEHEDHHLeC[t7Ht-HT$HHMD$fHL51MHSP@tfHE1E1HjLUj}H ۃH|$XHt~dH$dH3 %(Hĸ[]A\A]A^A_HD$L fDHH@@\HEXL1ɺH5 3jL1ɺH5o 3:+fLBLJ1ɺLBLJ1LBLJ11ff.LBLJDAWfIIAVι/MAUL H ATUHSHLj H$0H$H$H$Ld$`H$dH%(H$1H)D$0HD$81MHH$IEHH$H$H$H$H$H$H$H$H$H$H$#H)D$ H$L)D$)D$@HD$PHD$ `L$L$L$(H$0HHLH$xH$HH$H$HH$H$HH$H$HH$H$HT$H$UHDŽ$8@$H$HJxH$H$H$HH$0H$8HHDŽ$TH\$hMLLLBH}聻1MLEIM@HMLLPATUyH H$Ht`H$dH34%(H[]A\A]A^A_fDH}HT$HT$1MLEH@IjH$L3^L1ɺxH5 /TL1ɺH5o /$'fHHAE1PLIbHff.fHHAAPLI12Hff.fHHAE1PLI1HHHAAPLIHf.SHy1HH@t9HE1E11jHjjwH t'H[Hyf.LY1ɺSH5/ .[f.HHvCEEtHH !u=HHHNfDt[@HH PHH$@EAEt H Ett H EuH EEHRI11jE1HEZYHfD1L GH5 d-1HDHHHH2fEEtHN|EAEtHE`tH?ELH@f.EAEtH-EtHYEH)@AVAUIATUSHH >dH%(HD$1HT$Ht$uLd$LHH@A|,_HDHtaLsL L8AąD+A}t~Ls(AHL$dH3 %(DH []A\A]A^D L. 1E1H5T +@HFFAHF(@HD$AHC(x@L) 1"H5 \+K"fAWIAVI1AUIATUSHdH%(H$1G1ҾLAG41ҾLAG!1ҾLAG 1ҾLIG01ҾLAG$1ҾLAG(AG,IGHtPA@<AAF0~5H0>@!HH4@HH9@H9uIoLHÅOA=A =p j==$ 1ҾLLIF8&1҅ LIF@fA>vfLHDŽ$)D$`)D$p)$G&_IE@HD$I]@E1H9\$u6sAA A@HH9\$BHkH'tݾH't1ҾH3A>HAăuL1ɺ1H5\ (Lb1ɺ<H5= 11(uD1ҾLMLIF8,%1҅ L%IF@@@_1ҾLLIF8$1҅% LIF@?1ҾbL1ҾcLIF81ҾdLIF@IFP=1ҾLfLIF8E$1҅k L>IF@DAF01ҾLIFHrH= ?VHD$8HA A tIv@H|$8HmrLk1ɺgHD$`H IE@IM@1HL$HD$H90ALl$PL|$HLt$(MD1ۀ#5HL$(AADHD$HHD$H;D$HD$HXH$tξH$t*1ҾH0HHD$(8Aă 1ҾH0H+-.HL$(HA0@1D _A~  WIcH HJHL$HHѐf.1ҨD 8A~ 1ҾH/IcHH4HrI׀H9\$A61LL@E1Å,IW0qL&qLIG0j!tAGLQ!tAGL8! ML#!tAG LL !tAGAG$L tAG(oL t8AG,.DE1L1ɺ1H5b #H$dH3 %( HĨ[]A\A]A^A_@L91ɺ?1H5 o#DI8H|$8HRjHD$pHH\$8IH'jHH$H|IHiHHD$xHtWI@HiH|H$Ht/IHiHTH$HL91ɺdH5 1o"H|$8eRL1ɺ8fA@HfHfE1H|$8HhHHD$0Htt/HL$0IcHL`}DIcHt$0H|`aHD$0L0L9OIcDd$\HHL$@HAHL$HHDLHD$IFL|$HD$ AI!%tDIWLDHD$@IL+|$Ld`Il$I9H\$ _H|$LHuL1;_HH|$LL^uM1A}_ILHtHmI9tLmH|$ LuHŖM6L9t$0Dd$\-DLl$PL|$HLt$(AI}aHDgHt$`IF@HH|$8PIL 1vH5 H|$8Ouf.L 11ۺ/H5M DALJ1Ҿ Lf1ҾLI0PIHI8Å(ALJP1Ҿ L1ҾLIIPHIjÅALJ@1Ҿ L1ҾLIIHIÅ0ALJ1Ҿ Lv1ҾLI8`IHI@ÅALJX1Ҿ L&1ҾLIIXHIzÅ`L1ɺ'1H5 +f.1ҾLLIF81҅6LIF@1ҾLqLIF8P1҅LIIF@Iv@H|$8HMdL1ɺ]HD$hHf.H5 H|$8MLIF@:f.LIF@f.LIF@f.LsIF@f.LSIF@f.L3IF@f.Ht$pI8HI}H$HcIHtrI}Ht$xHbmIHtQI}H$HbII@Ht-I}H$Hb%IHsDL91ɺDL!1ɺ$1H5 WfLAGfDLѸ1ɺ#1H5 CfL1ɺqkDHt$hHaWL1ɺIF@HL WH5, $fL)1ɺ%1H5 _L1ɺ&1H5 9uLݷ1ɺLʷ1ɺIfAWIAVIAUATIUHSH8HQ8EOdH%(HD$(1HFLl$HHq@MG0HD$D$$AG,jqPLPAG(PAG$PAG PAGP`H@HHET$HL$ MI8LD$$LHE_@EA>D$ D$ ====+1E1L H5g @H\$(dH3%(DH8[]A\A]A^A_f.IV(I$HBHtD$ 7@=aIW8HDL$$DD$ HL繀Af1ҾLAIvHHt0Hu$L  H5p fAW@A>D$ tI$HB%HH$HEtYwI|L 1H5 A=t 7IW8DD$ DL$$H;HL{AHX)ADLy1ɺH5O @LQ1ɺ>1H5* A@HLl H5 FqL1ɺDH5 AyfDEE<H}A5aL1ɺFH5l AIW8HDL$$DD$ HLAqIW8H#DL$$DD$ HL@AAIWA7HLLbAIW8DD$ DL$$HHLAfL1ɺH1H5 A7@E_EHH6HDHIWA7E1PE11LjU蓝H AgE/EHHFHDEN0E+LIWAHxPUA71E1LFY^A@EF0E |$ D$$L-HLD辪LIWAUAL 1ɺC1H5J fIWHHPA7E1E1U1LjzoH ANfDEHHHEfDEH^HwHE|fDIWHH놅L-HLEIWHHY% DAVI։ʹVAUAATUSHHdH%(H$1HHH4$H1T$HLt$xiL11ɺkH@IHHHUHAD$ DBD$@BD$@BT$@|$HtWHMHHLHŋD$@ttLH@kH$dH3 %(%H[]A\A]A^HHE11Il$E1LDPHATjmH ŋD$@uHHBxL H5 LLHHB1H5 L yH5 LHAj@LH-jL1ɺuH5a 1ff.fAVIAUIATIUSHHY蛝C@Lc8thHHLLSŃ@L1ɺ1H5 'K@HC8[]A\A]A^fIHB11p uDI$^uS@Lc8;HHLLŃtg1LF1H5! ~K@WIHB CL1ɺH5 @HHLL#ŃyfDHHLLŃHPHLLŃHHLLŃ`HXHLLŃ@kIHB11wAWAVIιVAUIATIUHSHH^LD$H|$ Ht$hS LK LD$dH%(H$1HCHL$ ƒ@1T$h$pHLdHHQ@HXC@ =L H5 1E1o HEHLfH$dH3%(D)H[]A\A]A^A_AL֪11H5  f.K DL$LHDD$LeAnDC t$T$=L `C @=tmL yL1ɺ1H5 E1L Ht$LMILAfD$T$tLHutIHLL&AxH uxHt$HLh(AAIHLLA$…tLttL-aLUf…tH PptH }]H NQT@I1ɺ ff.fATIUpSHLH߃[]A\fATIUSHVtH߾p>LH߃[]A\lff.RfBfAV1ҾAUE1ATUSHHdH%(H$11ҾHHHkHIDHl$0H VH;ILHHlD$pMtH=DPL}D$p1A@lj|$@DB1@BIHXELHHDŽ$LHL1j$0D$tPD$xPD$|P$P$PD$L$H$HH$POH@HHH$HLHPBH$H;?<HXBHoLHBHo$HPB`BoL$pBoT$ BH$dH3%(fH[]A\A]A^AL5UY LLD$@D$p\1ҾaHAŅMtH=JNLuD$p1@LD H5 FLvH1Lɤ1ɺH5 LYÅ1L 11ۺH5] DML 11۹H5% H1AVL 3ML H5 VXZ6L1ɺ1H5 ' fL 1H5 L H5l fLi1ɺ1H5B dDSHdH%(HD$1HPBt}1IHft:HPBH4$tyHL$dH3 %(H[DL1ɿH5 fL H5l L H5< [f.DHLHfH#MHfSfD110[f.AWIAVAUL-s ATUHH5F SHIWDuLDE1AEIHHË494tU_t@A_tjEHLtkHD[]A\A]A^A_fA_IDDuA_HIkfDuHTfE1EA@DuAH.@E1uAWAVAUIATUSHL6H|$Ht$(dH%(H$1ILt$ D$<HT$L9HD$@HD$0@MeLd$M9#InM1DIwHM?M9uI$D$8HL|$!D$8HIL9t`I~IHIl$HYuIT$H|$HstI|$Ht$0@車LIxHL9u|$8~^MN1L H5 L 1H5 mH|$ wD$<HL$HT$(HHL$ IH9t9HD$Lٞ1ɺH5 9@H$dH3%(D$HD$0HD$PHD$HM/L|$M9tHEHMLHH$LHpH<$|tI $LLM9IHHvH|$HuHl$HEH9l$ M>HD$M/L|$M9uHD$@H@L$<D$<LMLY 11 H5 L|$( I?0HHnHuI?H@%3HCHMH|$HtHl$HEH9l$ @H$dH3%(H[]A\A]A^A_HuH|$H"D$<"M>L|$M/M9H\$Ld$0I@L臇tsH}LucHMO1ɺt$8L H5 hXHZtH|$HtHD$(IwH82HE<IELMM9qI]DH6CAWIAVIAUMATIUSHHl$@HD$HEt A@tfMtLL&1MLj1H5 z 27E1H[]A\A]A^A_@tFMtLLML 11H5  EtFMtLLpML 11H5K EtFMtLL%ML# 11H5 vE1ELvL7 1H5 *H1[]A\A]A^A_fM1H5g L 5317CH[]A\A]A^A_L 1H5 07DML H5 1QIHH5 H  H MtIPM1L VH5~ QRH f H MtIHMPL+1H5 XZ)@/7L} +MLH H Hf.AWAVAUMATIUHSH(H|$H4$HtHMtIED$A,MD\$HI $AtTEHDEwHtD HtH@HtCH4$H|$ЅuMtDHI EAuD$H([]A\A]A^A_H<$'}AHv DHc H>H@H@H$H@H@H%|H@@Mn*H<$wJH$H@XHD$H$1H$H@XHD$H%H$@^H$H@XHD$H-H$H@XHD$HH$H@XHD$HH$H@XHD$H?H$H@XHD$H1H$@\|H@H@ eH@H@HQH@H@H=H@H@&HH@Hp H@H@HH@H=\Hp(H@H=NZ Hp(HHAxLH<$辳6H<$訳 M \$0\$!DAWAVAUMATIUHSH(H|$H4$HtHMtIED$A(MtDHI E\$A#tTEHDEwHtDHtH@HtGH4$H|$ЅtMtDHI $A#uD$H([]A\A]A^A_A"H DHcH>H<$YH<$nH<$cH<$1uH<$gH<$YH<$茳KH<$=H<$p/H<$x!H<$lH$@[H$@ZH$H@XHD$HH$@[HMz@H$H@XHD$HH$|H$H@XHD$HcH$H@XHD$HJH$H@XHD$H21H$H@XHD$H3H$H@XHD$H H$H@XHD$H6H$H@PH@`H H$H@XHD$H&H$H@XHD$H'H$H@XHD$H.H$H@XHD$H/jH$H@XHD$HQH$H@XHD$H8H$H@XHD$H"H$H@XHD$H!H$H@XHD$HM\$AWAVA@AUIATIU1S1H#tN!HtIsEHcLHA)L1HIcLa A9~ Ń#uAE?H[]A\A]A^A_fDHG(H@AWH (IIAVEAUATUSHH(Hi0Li(H<$HHDA>ADDD$HT$H<$ L\$H=GHDT$AAEEH1MUL H5& AAZCA[L\$DT$ fDE1E1tvAEtfHs H;st\H<$DT$L\$ HsH<$HD$ HL$LH= H1~;L\$DT$H5: AZA[1L ?H5 Et!L 1ɺM1H5 jCC@xH([]A\A]A^A_Ð:E1EE1t$E EEfDEtDD D tEuEtC@%{@yC@mA?cHn1MUL5 1ɿH5 XZ3M<1LH5 Y@ML֠1E1AH5 1MLO H5{ CL\$DT$m1MeL H5@ C^C@f1MiL H5 yCf.E1A%1ML 1ɺ'H5 DT$L$ACL$DT$ DT$HM1L\$LFE1UH5Q AM1Lh H5) H,$AXCAYL\$DT$HL M1UA1H5 W_AXECY1ML 1ɺ1H5 DT$L$DT$CL$EH11DUH5` MLd Y1^HLH=v 7HT$1HLH=t DD$6L\$DT$ LD1xHLvF 1H5E ~@AWIAVI1AUIATUSHHH/HIIHta8/HufH;/t/HHu5LI}HH)SHHtiMtIHH[]A\A]A^A_ÐML 11H5i L1ɺ1H5K L 1H5% vfUHH=E SHHt]1HH/HH)HuH}HH[]fIٹ1L H5 H1[]AWfMAVLAUATIUHSHHhH|$LHt$dH%(HD$X1)D$0)D$ )D$@HT$0A[t]HHT$ L1A׉Ń E1MtID$HtDhHL$XdH3 %( Hh[]A\A]A^A_fHI9tAŽLt$tDLHHt$H|$AAMtID$Ht@DEAt!L1ɺY1H5] D9HALH9\$7JtLa1ɺT1H5 D11L-NH5 gNE1AWAVAULATIUSHHH<$I9IE1pLHH<$AAMtID$Ht@DEAt+L1ɺu1H5C DL$ DL$ HD9ALL9tKItLC1ɺp1H5 tH[]A\A]A^A_E1MtID$HtDpHUHSH/HHHt%H1HXHHtXHH[]fDHXHHuIٹ1L H5@ LQ1ɺ1H5 DHtGHFHFHFBPF LF(HHF0U1HSHHHL!HxD$t)L 1H5" eL 1H5 r<AWAVIAUATAUSHHdH%(HD$1HFX@Ń!H-@HPzC[0AHBP"IvH=H{PDHL tL=w1ɺ'1H5 E1pt1Ht'HOLxHIGX@7rN*H{Pa\1Ҿ4L*AŅHCPL H5P L1;fDDHLHCP@uAcH8sgHL$dH3 %(DOH[]A\A]A^A_DHL1 1ɺIH5 1A&@H nHI@;1M,L H5c @11HM'fHH誕LxHIGXLLwAAŅLL@HIHL AWI1H5 3XZB@HsHCPHL7 IH5j 1E1VfHCP1LD$LHD$HxH' L I덐HL 1ɺI#fHHHH5 UILu 1$Y^XAUATIUSHHHFX uc@@u LKH1H5> L 1HHL[]A\A].fHHe IHtGILs 11H5 YHEPLEHHALLH&HCXCDH[]A\A]DH HHwHCXff.AUATIUSHHF[t.Ht$HĒHhHHEX@H ŅtR7uH[]A\A]C[tHtH0 tHLA1Lq1ɺTH5 'H[]A\A]f.HL=UHHIzH"71PIL/ H5E @H11AUXZff.AVAUAATIUHSH ;H]H9tgL5qf.HH9tL:uWH{VtHsLFuM1ɺtH5 E1HH9u:[D]A\A]A^Lp1ɺn1H5^ E1fUHSHHKt".Houk}H^uZKHMu!5tpEH[]DHߺKEH[]1L H5  H1[].H{}Hf1ҾHOQDAWIAVIAUMATIULSHHHFA[H1A]H5N4 /ŅU1A[HA]H514 HAE]HI^H߽fAH[]A\A]A^A_fHsuWHD$@$HWELn1ɺ1H5 OD1H߾L 8LG H5 ҃HD$@H LD11\Lm1ɺ1H5V 11Ҿ$HEL 1ɺIH5 1fD1ҾHILHAE;ŅtbAuHL? 1ɺIH5 1"$D\HuG1Ҿ]HXILl1ɺ1H5V f.L 11H5! DAWMAVMAUIATIzUHSHH21ҾzH+AEA1ҾHEt1ҾHHAEMAAIT$HHHHH HH H HHH HуH ugubttUEI\$(01L? IH5 @11ɃfEHDeAtFEA+Cu A9r`t\FuUH[]A\A]A^A_ÐEt601L H5\ @11EfDHXL[I1H5 H1[]A\A]A^A_þHCHID$HtAEAtKuDAEf.1Lr BH5 1DAEfDh1jLF H57 ZY1H[]A\A]A^A_f@H3LzEIf.1ҾHAAEA1ҾHъHߍ4uIk.1MLg H5 @11DeAWIAVMAUMATIUSHHHT$tU1ҾHHAŅA7H+L 1ɺmIH5 1g1ҾH8HL$1H߾"1ҾHA$_A<$Iu*Ht%H=Z H@@@QLs@H@I92E1InHtZdIHMtL`H1ҾbHHH辻HLHTeŅMM6I9uMLoHHH8t%H5(HWnIHHIGL;I߽fI\$LdIHuM}&DLf1ɺj1H5V H[]A\A]A^A_fDE1M}۹R1E1L H5 L,f11xH5 bM}Lf1ɺ1H5¹ 19Hc@Le1ɺ1H5 1MLe1ɺH5X 1ME1@Lie1ɺLYe1ɺ1H5 E11uDAWAVIAUATUSH8F4H|$D$F5HT$D$HtHD$HX@Lh@L9)E1DHkHtXaIH*MtL`H1ҾHHHHLHTbMHL9uMLlIHfHD$ H=M}HpD$(MIF81HD$ I/H5 H99IG Ht DEL L 11ۺUH5 MLaMuGH8[]A\A]A^A_fDLc1ɺ1H5> M1MtDLDHoGaHHuDH@AVH9tAFMM MDLc1ɺ1H5 71LLb1ɺH5 H5HIG HDEH@AV H9SAF GE1E11H|$t?H|$]1L-HD$Ht(M]L &#H5 H)t4IG H.8$H@AVH9AFH5)HIG H0H@AVH9NAFBfDLYa1ɺH1H5 (H|$1Ҿ8D$DAF5H|$1Ҿ8D$DAF4L`1ɺ1H5 M E11E1GL L H5FHþtBIG HttL FM1H@AVH9%AFH5HntIG HttL :H5BH@t+IG Ht`8u[H@AV$H9AF$H5HtCIG Ht.8u)H@AV(H9{AF(oL L H5H謽t+IG Ht`8u[H@AV,H9%AF,H5HntCIG Ht.8u)H@AVH9AFL XL H5THt+IG Hte8u`H@AV0H9AF0H5HڼtHIG Ht38u.H@AV4H9RHAF4BL L }yH5HD$,t0IG Htl8ugH@AV5H9HAF5H5H8t|$(tCIG Ht.8u)H@AV H9AF L L \$,L ~L RH5V 1MʿH5DH覻t0|$(tzIG Hte8u`H@AH9AH5#Hctj|$(tSIG Ht>8u9H@AVH9AFL (D \$,L D2L \$,L H5Ht;|$(IG Htq8ulH@AV6H9SHAF6CH5*H蘺to|$(tXIG HtC8u>H@AV7H9 HAF7L j<\$,L ZbL  \$,L FH5gHt?|$(IG H8HpH|$ D$,tHoH5<HĹD$,tRIL* 111H5/ 訽/LL[1ɺ+H5 M~\$,I5LЯ L .\$,L TAWHAVH@IAUATUSHH|$HT$dH%(H$1HW@HD$H$H9t+H$HXH蝻uiH$HH$H;D$uAVHuIVI9H$dH3%(H[]A\A]A^A_1ҾH!IHtE1LIc{H9iLH\$0L|$p1fLD$(LHH5i H)D$0)D$@)D$P)D$`)D$p)$)$)$ HH=؆l$(HH=# HH=5HH=H=HAH=HH=K HAFH@z1IV(H5vLANH ODHT$,H5vLD$,D$,=<=9HD$A(fDLH5L薭-I>dANH@IVH5qLeI~daANHf.LW1ɺk1H5v Iٹ1LOg H5O ȹ1LoW1ɺH5. 觹1IVH5ɅL转L-W1ɺ1H5 cofDLW1ɺq1H5 7CfLV1ɺw1H5 f.IVH5)LANHTf.ANH@fDLiV1ɺy1H5& 蟸f.L9V1ɺ1H5 o{f.HD$H=I HAFH 1IV,H5sLB,LU1ɺ1H5o LU1ɺ1H5F 迷f.H=yH HH=HI~8IL 1H5ɨ BuDIV H5aLULT1ɺ1H5 fD1ILc H5P ɶ1"fLiT1ɺ1H5& 蟶f.ANHfDL H5 ^fLS1ɺ1H5 /;L6 H5 ;IV0H5qL ANHWANH@MIV4H5qLANI'11ɿL( H5 茵1H=[ ^_D$D$EHD$XfA@LA$-)H)@)@ )@0H|$lH1ɺ t$`I1H5>v L 谄I,AYAZH A$-D$bH$HD$XfE1H\$H$DM))@)@ )@01Ld$htX衪HtIsA@LH1HcA)H|$XHIcL d}A9~ÃuDLd$hH\$Ƅ$H$A$ -D$HD$ L5YZ HtLpH|$t$X1ɺ AVI1LR H5t YAZA[bH$HH\$Xf)H)C)C )C0A$ -H|$D$葝H1ɺ SIH5ht L 1؂Y^D$ fH$HLt$XfA)LA)FA)F A)F0苏E$ -H|$EuH1ɺ AVIL 1H5s HB_AXH+- A$-D$PH$A$ -L5X HD$ HtLpH|$jH1ɺ AVIL 1H57s 谁XHZHL,M/ A$-D$D$\H$H$HsHtL$dHT$(H|$PЅHsHLNH1ɺ' HD$HLt H5r 1A\A]H$Lt$(H|$PHpLH$H|$xt"IFHthD$$$9LÉ$dLM1ɺ- 1H5 r 胀H5ڸH=D$EL1ɺ4 1H5q Lt$P7zf試HD$ D|$dERH$Hx荚 L I @L1ɺ 1H5Fq DŽ$H5H= 11裌11zH|$xDŽ$HD$(H@Ht $H$($($($($($(輋H0$H$dH3 %(H[]A\A]A^A_1HcH[HHD$hHh(H^H`(~Ht$H|$PE11芄H$H@HD$ AL$Ld$hHcHIHIA$a(I$h(HuEZH5p H=bkHtLpH|$蝘H1ɺ IAVLv .L1ɺn H5So }$@H|$lj5HBH|$HX.H1ɺb SIL( H5n 1u}A]A^g@Dt$dED$$˗H 1t$`I1L H5n }XZH苗H1ɺ It$`LZ DL1ɺ 1H5>n Lt$P|HL$L71ɺ H5m o|H|$H1ɺ_ ISL D1L&HD$(H L1ɺ{ H5m |H5]H=+a1111ψDŽ$?H|$NH1ɺ t$`I1LS H5m {A^XD$Lf H5l D$X{DŽ$DŽ$H={4DHD$@HH{4HH$L+H9 H$0Lt$Hl$HHD$0ifHCHt$0H@HxHڇLsDD$`IFL`HEu}|$L5<{4L%z4IELL;,$IƄ$0HC@Ht$0HxH 6nL1ɺA H5k /zJL}L9uu@M?L9eI?-uHLGquLHKL HCHuz4H@H@HHy4Lt$(HT$@H ey4H|$LxAvtIFHHCH1ɺ[ L H5j H@LHHHD$H1MyXZH5x4Lt$(H|$H$LH|$xt$IFHtDxED$$$9LÉ$twL1ɺa 1H5Mj xH5H=!D$ELI1ɺh 1H5j Lt$zxDH5j H=HKRuDŽ$Dd$`EvDŽ$L1ɺG 1H5i Lt$w?Lt$11kH5t4H=2x4}H|$@-ul$`uDŽ$DŽ$\$`=D$]D$nD$lLtVIGL 1ɿ H5h pHHD$PL1w_AXAWAAVMAUIATIUSHHH$DL$xH$HD$(H$HD$`H$HD$hdH%(H$1HC @D$ [H$HHD$H$HH$H$HHD$H$HHD$H$HHD$8HC @L KHDŽ$0AH{Iu蚩PLZ IH8@/HgkIH; H$0LHȎL!1ɺhIHL% MM|$ 1HpwHHtG/HjHt5H1HiHHzMHLIlIM9\ A4$fDLl H56f 1At1LN1ɺEH5 f tHD$(HD$@H|$($($($($($($(рH0DH$dH3 %(1Hĸ[]A\A]A^A_ÐMH{L˧H{H4$HF#MLfLIeH{M|L֤IHJHM1LH LPw(H{Ht$LGFHD$(HD$@H HD$@DXEt HxS H|$tH<$D$ H5uHarAH 1ɺzH5[d 1L rHt$11Hzb L<$L6D$|H<$tH|$H<$L$xʁDщT$xE Ht$H|$8H$0~HDŽ$DŽ$DŽ$~L$L;|$8D$0%H$`HD$H$HD$ H$HD$PH$HD$pfMwIoDŽ$DŽ$Ƅ$`MtHt$@LS[Ht$Hn~1 H|$ L$L;l$Lt$HGDHPcHLHHD$XauLLD$XL)I9 MmL;l$nMe/LfIHuHLhuH|$ MLt$HLMIH<HED$1HL$d H5a P1spAYAZ1LD$P1HHHLHHH$PL$D$$bY^HIH$HPH$PD$LD$H$$q_AXH$t7H 1ɺHHWH$r$ $uzt$hLE1Lt$hHLL$PHT$0AXZAH=~H5a 註Hp/1ɺHHWfDL~LD$P1HHyHW11{M?L;|$8$X$X$X$X$X$X){H0D$|Dd$0D9DMH|$( Ht$@HEAGAIDDd$HHD$0H$0HD$@@HT$@HHX8/I|/HcIH$0H{L訡H{H4$H@H{L脡H{Ht$Hs@1 IL;l$0 DŽ$0Im}@HLeLtdH{L H{Ht$H@uLg` H5^ AmgfDIA?/tLH賊IHWH{L諠H{H4$H?L^LH^H{HlH违IHHM1LHl H9pH{Ht$L0?L_ H5] A0lH<$AŅHD$@DhEDIL` H5Z] k6fDHM-IH@HT$HLAhLDODd$|H|$L 1ɺfL$0H{LH{Ht$H=LG^ H5{\ AjGfDH{Iv諞H{Ht$ H=L] H5"\ jH5H=D$0Lt$HLd$fH5H=踶D$0eL1ɺH5[ j5@L1ɺH5s[ i@11LH5N[ iH5H=D$0H$Hp1ɺHHfQ.H$AyD$0L@11LH5Z /iDH=ZH5~艵D$0HD9DMDd$0AHqVL@L1ɺH5;Z h@H(VH$ÎfDMH{LCH{H4$H3;LZH$0IsZH{MtLRIHvHL$01LH LkOH{Ht$L:wL[ H5FY AgfLZ f.MM 1L9d H5X hgD$HLD$8H$Hs H{HL$mfL1ɺ H5X g@L1ɺqH5kX AfbfD1H辽HD$@HdLi1ɺJH5#X AffD|$HL.1ɺ 1H5W dfD$HL1ɺ~H5W A+ffDL1ɺ1H5W eZf.HHL1ɺPH5;W Ae2fDLQ1ɺH5 W e@IHIHL$0LMs 1H5V A*e~DLhL$tH{LИH{Ht$H7xLX [H5GV Adf.LD f.L91ɺhH5U 1Aid@L f.L1ɺH5U !d@HQtLH$/rf.LW H5PU AcLi1ɺH5#U cML6XVH5T AmcLV H5T A8cL1ɺ H5T c#@Dd$HAM@LsV 1ɺ1H5VT AbH@LU H5 T AbL<1ɺtH5S 1E1obLU H5S ABbUMHAUzL V Lo LDH5S 1bA\AA]K-Yff.fAWIAVIAUATAUDSHH8H$pHL$H$DD$ HD$`H$xHD$hdH%(H$(1mNn1L\U 1H5R MaAH$AMHDDH$D$AHD$HH$HHD$H$HHD$xwEaAD$D$pL$pLl2fI~LtI~HHe3HI9L;1LL lH$pI9uHtL~LbI~LI~Ht$H2uLUS H5Q `D$pL1ɺ1H5eQ _$8$8$8$8$8$8?lH0H$(dH3%(D$pH8[]A\A]A^A_fD|$pnIF @tH|$HH|$D$(DŽ$"$ uL-HT$Ht$xLfH$H9}AL|$5oLLAMoAU(KHH9t~I~@IHYIHsL&IEHuH{A0HLKLfR PH5O 1!^HAXAYH9uD$pAH$@HH$KjDŽ$DŽ$jH$HD$0H;D$xhH$`D$tMHD$XH$HD$PD$($DŽ$HD$0DŽ$LpHXƄ$`Le5 HtHt$X@HvHt$XL!j<! LD$P11LL` MLQ 11pH5KN \HHLDŽ$LH$P$D$L$uNIAE1HD$PZYLH$PH$PH$$H^^_ $$D$<$$HD$@HHH$pH$PhhH{hH@Ƅ$]HD$`IH|AD$t I|$HHHH$HD$ H9H$AL|$HD$HD$ H|$E1yD$(H|$HHL2AD$tID$@$Hl$ IMHD$`IH1LIHnL1ɺ1H5> MH5UH=#Y11Y11YLLHHY!@LQ1ɺaH5 > Lf@L)1ɺH5= aLI@L9H$kr fDH$H|$MifH;OH?L9uIF @IbLZ 1ɺIH5<= 1KIG11HIHCHHHLHD$LHD$IGH$yHL$Ht$H$ H$hHo$Hof$XHL$`HT$(LHt$ HD$hЃE$|H$fDIGLH$H$ HL`H$hHD$ f@h@xj@LL耢L1ɺH5; IJ@L1ɺH5; !J@L7H|$@.plfLL5Hh`AED$pD$pLX H5 ; ID$pL91ɺo1H5: oID$pH$Cf.LiX 1H5: ,ID$pH$L1ɺH5s: H@Hp_D$p11U11UH|$`$$$$$$UH0f.L1ɺDD$pH$h$h$h$h$h$hTH0L1ɺ$LLE>+?AAWAVIAUATIUSHH|$H|$ H$HL$dH%(H$1SlTI~hH޺@Ƅ$SIIIH$H9E1Ll$PLt$DH{wLHT7HSLHt$H|$HD$AMtID$Ht@DEH5F9 At(H508 1ɺL1LSFH5~DH=D9AL11SHH;$D$PH{@L0(L1ɺ@H57 )F@L1ɺF1H57 EH5N~H=Rt$Ht$Ht$Ht$Ht$Ht$HURH0H$dH3 %(H[]A\A]A^A_fDDMtID$HtHf1ɿL8H56 QEIeIHR1ɽ[L葴H|$LIHEL9uL|$0L賴D$NH$Ll$H;l$t"HHU1HHPHmL9uဋtA0$ Lt$LL7O 1ɺGAH5/ 1=HLHMIHD$M.LM9HLIIELLM9tzII1HSLHuH{HLKL41 P1OH5v. LeID$0L 1ɺ1H5" C1I~GL% INGLE 1ɺIH5|" 10ANTI~G;Ly% IGLKD 1ɺ4IH5'" 10ANTMfLIĨAGHLD ATIH5! 1T0Y^HH|$襦H|$(Ʀ)L% 1ɺ1H5!  0I~FH1ɺLd$PI1L3D H5Y! AT/ANTH{LXZcIFHL$Ll$ L;d$ t HIT$1HHPM$$M9utA0u1ɺ)H5 1LD E/HHT$ HDMM4$ML9HLIIMLL9II$1HSLHuH{XHLKL" PH5) 11.XLZѤH|$L4I~9EH1ɺ(Ld$8I1LA H5 ATJ.ANTH{LAZA[bIFHTL〣H誤tH|$(蜤S H|$芤u |$H` D$0MI$ML9H\$PHL|$XfDH1IH H辰HHtHHt$蕺Ht$AD$T  tI|$HHt $HIIH9mHI|$L-BtLCH1ɺeAUI1H5m L! ,It$A]E1A_H~CH54 1L>B Ih1,It$Dl$0I|$ACL! 1ɺmIH5 1],AD$TI|$CLA IH5 1 ,H|$LsLvAT$TufDHuEifDHAPLG1H5 +YL$> ^1ɺH5 1q+4L1ɺ1H5 K+HΡH|$@HE1薢E_Et_H\$Lt$@IH$DL$L9u-f.HL9tH{L,"uHH-AE9owH\$IHD$A0MIHML%o@ ImL9l$M(蛑FHEIIH;l$HMNM1ɺeH5 1IP&*AGIVE1IvAVHPEOS0AYAZuH|$LNyH|$H<L11NH5B )VH|$H LR11H5 )#L &辞MImMM9u!fDHEIIL9HI}tI}?L> 1ɺIH5 1(H|$(LKL|$PH54HD$0H\$PL|$XH|$<^|$HSLB1ɺK1H5 x(;L1ɺL 1ɺH{Ht$HHT$h \HT$hDL$0HB0EL1ɺH5t 'D$L 1ɺ+H5H 'D$H|$?u |$HA0M(M{L= 1ɺy1H5 a'I(HHD$@HMIEMHD$H$HD$PL9l$HLICTI}(XIH%HD$@HHH9t+H}HCH;G@usH}H9G@dHmH9uLK1H5 L &H|$LԜLd$I$LL;d$tWHD$GHI踝L 1ɺO1H5 "&L1ɺmOLIH$HD$0LmIH9l$L|$L}LH 11H59 M%HD$HuHHP(IHHT$0oE11H) oP)RHuLH1ɿPL1MH5 7%_I|$@AXHD$p t=1ɺH5 1ML $I|$@1Qr1ɺH5H 1ML; $1LH踴ۇ1MH5 L1; @11Ƀq$Ht$@HD$LfHIEMLL;l$IHD$0tETuH|$豚u |$HH{($UHD$@HLT H5V #H|$L'kML6: H5$ #H|$L4M1LmH5 d#H|$L跙MLn9 L|$MMI.MM9u_fIvHMn;1L9 MH5^ @11"HEIIL9tEHI~6uMNL9 H5 "H|$LߘL$L%v9 ImL;l$(HLIXI}{IuL?Mmv1MMH5 @11"HEHIH;l$(tEHI}suMML8 H5P !H|$HLH_H$Ld$ H;l$ tH}ʽHmL9uIL%< Ll$H9l$t6HC(Hu1ɺMLH5 1H5 l /ML 詤1L$ IH5 1% HEILIF辕IFHT$P1E1Lo)o`)bHs)d$0fL1ɺq L* 1H5* H|$LL:1ɺ1H5 p3M(L |H5 Dzf.AWAVAUATIUHSHHLi_HL IsLHH?MuLHImHHHp%؁1MUL]8 H557 @11ɃnH[]A\A]A^A_f.HHHHD$L1L!LT$MuMCLLLT$&L6 ,H56 LT$LLc1ɺAH蘩GL6 udH uGHګHRL1ɺRH55 ;L6 K1H55  H[]A\A]A^A_L1ɺD1H55 H[]A\A]A^A_LK5 1 H5U5 L5 1H5%5 dM&1L 5 H54 1LT$LDeff.@AUIATA1USHHdH%(HD$1H$rHHHHEVzHDE1HuE11LPHUjwH H<$A 1zHHtHL$dH3 %(Du8H[]A\A]ÐLAt 1aH53 A&_f.DAWAVAUATI USHXHt$dH%(H$H1@HHI6LHHJ1H;Hl$@ HL$0L|$8Ll$HL$Lt$(fDCHúHHs &QHL$11MLHl$(hLl$(LLpuHAM1t$8Lc4 H53 HD$ XCZpLl$A*D$Lu11'H53 DL$LDL$DL$H$HdH3 %(DHX[]A\A]A^A_L 1ɺ,1H5K3 ?E1f.Lٶ1ɺ#1H53 E1s1ɺ9D$LH52 Ll$DL$(fD1ɺ>D$LaH52 Ll$DL$fDL2 1ɺ01H5{2 oAff.@ATUSHHdH %(HL$1D$trHtaHL2 lH51 1AHL$dH3 %(D8H[]A\fLI2 1YH51 Av@H1H0.HHxHEHFHt$H=DL$EH5"HA 01ɺHHHHH`H|(H߅'H7,HADHHH诮y1I麚L0 H5E0 @113Hk+1ɺHHAH5G*  L11L, 8H5* sff.SH Y9CPtH߉*-ÅtD[1_%L+ 'IH5) 1( [@1LǪ1ɺ,H5q)  [ff.AUATIHUHSH8dH%(HD$(1@oUho]xH]hH)$)\$荔AŅHHH9t#HPooKJHH9uHHLAHt$(dH34%(DuuH8[]A\A]f.1E1L* H5k(  LL* 1H57(  xff.U1HSHHH9wR1ҾH[;H"ÅtgHÅH[]H߻'LL* 1ɺzIH5{' 1 H[]fD1L1ɺH5I'  H[]fDH߉ƻY'H1PL1L) H5& XZH[]ÐLL) 1H5& U S1HH߻(t [DLǧ11ɺoH5o&  [fS1HH߻}'t [DLg11ɺdH5&  [fAW:AVAUATIUSH1H 1Ҿ7LH HtuHtpLYHL€uHƹH=ALMu9HwL-LLMtHtHLLtH8H;AŅHH=rHHdu-LXHHC`L7HC`H HLu?L1ɺ1H5`$ H[]A\A]A^A_f.HLuH XHHc`HHHǃH9tHPHHǂH9uHQLHHD$I9tGMwLt,HH=AuHIM?L;|$uL=fHLuK,DHHLHǃ荒HLuOHL=H;l$t,f.LmLTtMHmH;l$uހc,f.HX8H蘻(HHt&H=uID$(xz~HBi1L& IH5P" @11ɃH[]A\A]A^A_@HtH=UHI1LO& H5! vbHHHc`LHǃH9HPHHǂH9u@L1ɺDHC`@H1H5C! IAUuL$ Y^YfLL% 1H5 qL-TLDH1{ULL<$ H5 8XIZL\$ }1H5 f.HC`LILy$ H5= fDI$HǃHt H{Hl7H0H`LqmkH`L IH5 1FSff.ATUH1S`HHX HtntgL%H$ ,fDH{?t_Hu6tzH[Ht9t2tL# 1CH5 H[Hu[1]A\fMH1H5 pfD[]A\ff.AV8AUATUHSHHLadH%(HD$11H߾75HD$IRu.HT$dH3%(H[]A\A]A^HLMtzH=Lu`LHEmLH-uLLL" 1ɺpH5 3@fLH 1HL$HHD$tA$HH=6uAL$1Li1ɺqH5 9HSHHzL1ɺtH5 IVA$HH=#AL$fDL11ɺkLY! H5J  fAU~ATIUSH1HLH%;HLHHL_}I$uUHtpHtd1H5 1LI! /L}t!I$HHKLU11ɺ(AULL" H5. HHXZ8H(Ha1Ls IH5 @11ɃbH[]A\A]fH1I$HH1H5 IPL'! 1Y^L1ɿ1H5U Lf! LH1HH=|! Htt oDAA|$MII9tHsLTHL9uLD.Å"II9ufHmL9H} tH}G[@uܾuΉD$ HML SH5 A\A] AF`%AML讘L,>D$ `II9qD$D$D$f[`+H]H'uA@H-#H蝵uCYuoH臵ucHCXuXuQ@uJL}DH߉u,AZDHLD$D$fHmI93.`DL$EtG|$AD$L L H5 PH LD11_AXt$t |$ZI>rL$LI+[1AمL H5 @H11UXZHL$(dH3 %(D$ H8[]A\A]A^A_H踵@[yH覵HifDH0=CHM3HHCXA@L1ɺ\1H5I L1ɺ 1H5( D$ fLL1ɿL/H5 nI>ufMLZ 1H5 5YHAA1Li H5u 1[]XD$ XHL$$LLrD$ qXHDL> HL H5 HD1ɺP1ADL$4AZA[fDM1ɺ1L9 H5 HD$ HLCXLg 1H5d D$ ND\I>SffDLi1ɺH5 D$$ff.@AW}AVAUIATUHSHdH%(HD$11_SH0!0E1L sHtLHAHL9uEtVLL%IW1L IH5 @11HZtV1ҾHWLHjJHL$dH3 %(DH[]A\A]A^A_f.eHKHtLD$J&=YH{LHhLs1ɺH5 DHY.CL)1ɺH5 aM1ɿ1H5 L (LH}L1ɺH5c L1ɺfDL1ɺ1H51 X`TRTHL$LHH5)A1TMDt$H~HDT1ESL H5 AW@11Ƀ6XZE9LԎ1ɺFL1ɺ3@AWIAVAUAATUSHH+AHHvA_HV^ HAH,t&eHLB  -HMHt6KH1ҾHYHt&}HL? nHZt)1ҾHL6 4H t)1ҾHL$ HEuAD tEtHtt ȀHtHC(@w[~RA1HjEIHHHD1PHEE1ATLjHJH LH߉GH[]A\A]A^A_fDDHfD}HfDH%H HqH\HG H2HD L H5 1@H;DH&_H H1@KHkYHVeHE1>AYH#\xfD1ҾH  z@HH= G6%L D$ H[]A\A]@1LR> H5 Daf.SHHtHqu;[ZL1ɿH5 [Hp^L AH5 1f.ATIHUHSztfHH趙Åt HLH[]A\Ð1L; 4H5 []A\DL 1'H5 []A\ATIUSHu2HHE1PjjLHE11?H []A\@HAHH HPjjAWAVAUATUSHdH%(H$1L$HILL2aLH芞I1H߉$Hl$PH$ L$RzIHHLt$PL\LH[IH5rH*HT$8H5VHnyH>H4$1ɺH;@HTm<H<$1YH1H8IHLHHT:HdeH4$HHHH@H@@YtHEHHHEXt$Ht$H8t$H4t$ H Ht$0Hkst$(H_ HLHIH9D$t!L 1ɺ1H5B IH9D$t!L 1ɺ1H5 HhtbLk@L{@M9tUMuL/t01ҾLHVHHVMmM9uH*HjHT$81HHk H<$/u=H4$1ɺHLL5 MLBAUL AVMH5 11Ƀ~XHZԠHDLH8fH$dH3 %(H[]A\A]A^A_fL H5e H<$'toH4$1ɺH0Lm|1ɺY1H5 NfL9|1ɺ>H5 qL |1ɺ@H5 AH<$gsQH4$1ɺHL $1^L H5H fLy{1ɺz1H5 H<$rH4$1ɺH{tWH_LH6f.L $LM~QH5 :Lz1ɺH5x HH'TLz1ɺ]H5: HF1LH5LPz1ɺiL=z1ɺXH5 uH1u1L>5 cH5 0Ly1ɺH5n Ly1ɺ]H5J Ly1ɺXH5& ZLcy1ɺo1H5  H"`HM`VLy1ɺ1H5 OLx1ɺH5 &rLx1ɺH5i NLc H5D )LL$8La H5 H HkLLx11H5 1Ҿ7H1ɺHHIygH5gHRMH5LzH5C LcF=L H5U 11qL-}MLww1ɺH5 H"thHHX[]A\A]A^A_fDL 1H5 DDHPHLmIfLj1ɿH5 NLj1ɿH5` HH%11LEjH5( f.L\% 1H5 L}f.ATIHUHSHH/Hc`HRHHH9tHHHHH9uH败txHtlH.1L 1IH5E @11Ƀn[]A\@I$Ht H{HHQ1Lh1ɺ/H5 []A\DIL 1H5 []A\I L f.ATIUSHu&bHMtHL>HWfL)D$`)D$p)$^>1HH߉$ Ј$[H5dH߃$ Ј$rH2H$E$AELMl:fDHLxHLH=L9HHuHIHuLML~ H5g 1HJH$dH3 %( H[]A\A]A^A_Ðt'HB>fL) 1ɺ1H5 $fHl$`L9t%fDHHU1HHPHmL9uL 1ɺ+1H5| H-lLHHaLl$`M9uL@MmM9HIUHHHuI}I}HHL& UI;H5 1]A\oLc1ɺH5 CHl$`L9u#HHmL9Hu1HFHHHHtH|$xHuH{H%HD$xHuLb1ɺXH5 'fLH5 }L: 1ɺH5 $H}}LL, IH|$xHl$`L9tfDH}`HmL9u1ҾHwy11L H5 ?H1JHHfDHHIHtzHD$`L9tL;hu L9htHL9uӻHLhHLk9LZ ZH5s 1HL 11H5: ^Hl$@L9t$DHHU1HHPHmL9uHLH'^Ht$11HGHHHH|$HsHH1wiHt$H|$1L= Ll$0L;l$uMmL;l$twI}Ht$跹uHL$H|$LA辀yLc AUULL$(fDH|$xL2 `VH{Ht$L_1ɺIH$HvLO 1ɺ1H5 Hl$@L9tH}]HmL9u1ҾHv1ɺ1H5A L ^1ɺHH$7Ht$x1ɺHL1H\HE11HD$0H߁PH$LL$4ӲAZA[HHDL$$EHD$PHHD$S6Ht$1HqOLLM9E1 M6M9I~G IFHp@HE1E111H-tIFAHx@Ld HIH5 1LL$x1Li H5 ȿH|$xTf Ht$x1ɺH蒧& H$TM H$1ɺH^L]1ɺH5# 1@L\1ɺHL$xH|$1H(pHL$xH|$Ht 1CLL$xL 'Lg\11H5y 袾H*LC\1ɺ/L0\1ɺ1H5B fL$L IL LL$xL vLL$xL H5 ]LL$x1L H5 踽HH|$xRHt$x1ɺHzH$RH$1ɺHFBD1L H5 "1L H5 HH|$x.RHt$x1ɺH¤H$QH$1ɺH莤HL?Z1ɺH5N r訳41LLK H5 ?91LLM H5 LY1ɺH5 _H[1ZLpY1ɺH5 註!Hs1E HL9HxL|$`HW@M9tI9Wu \@I;WtRM?M9uL$@L D2LX1ɺZ1H5 LHD$+1H|$L0HD$HL9_HD$`L9HxLoL fIPH5g 1AT臺ZL Yg1H5: cR1ɺH5M vLR1ɺH5, UHȡtH1mH谡tQ1ULQ1ɺH5 iLQ1ɺH5 ݳLQ1ɺH5 輳f.AWfAVAUIATUHSHHHLaH<$dH%(HD$81)D$)D$ D$0H9u Hx@tHH9H{9HCtoHT$H1ML H5 )\$o`1)d$(R(XZHT$8dH3%(HH[]A\A]A^A_DL耞D$ M1Lt$I9tDIGH<$E1LoHHXHp@A)oPA)VM?A$|$ I9uYL6tLzg=L 1ɺQ1H5 @LPsD$ ?f.AWAVAUIATA)USHHdH%(HD$1D$ctH5aH߽zHZH4HE1e,eH1HIHHD$HE11IFALDH$Hf@PAVj H ŃD$HD,DL$L 11H5 fLH HL$dH3 %(H[]A\A]A^A_fDLqE 1H5  f.L 1H5 ܯEhH@2袠WDHAJ)L H5/ 耯 LH5 VLd H5 .fL 1H5 HȇL4 H5m 辮fLYL1ɺ1H5C 菮ťDATIILA U1HSH5~ 1RE111HL谿HHt Hou H[]A\@L1L H5 H-Cu)1ɺHLǕt3H1詽L8t5Hf.LIK1ɺH5 聭L(K1ɺH5 `ff.AWAVAUATUSHdH%(H$1H5IHD$(LӅH31L&D$(HD$HCHD$EHDHD$ HD$`HD$@@Ht$L#LLJ1ɺSIHYHt$LIHIXHtfI$XHtY9HFH kH5N IL 11ɺHLLLLp1pL9tLt9LuI1ɺvH5 1覫H|$@RHt$1ɺLpLPH|$@fHt$1ɺL:"LD$(9MHD$HD$\$(H;D$ 7HD$1LH0E^LHHD$苶H|$HމD$,*"L5H\$Ht$HHLIHHt$LIHH|$?sHt$1ɺLB3L"LG1ɺ^@H5I 1L H5 D$(fDH$dH3%(D$(Hĸ[]A\A]A^A_LL$L GH5 脩E1ɿLGqH5~ TH|$>L躖2LZDLF1ɺH5& @LpL}LF1ɺH5 蹨<@I$XHt:IXHt.L9IB"LLL-IIHD$0L;H9f.HLMHLAI~HkI$HEpHCI$Hx@輾H L\OUI1H5 ЧHCLH@H L_M?AXH;D$0dI$I$IIHL$8HT$HH9Lt$XL|$HLd$PLd$@Ll$0IMuI9I @HmL9tyHELHX H/tH/`@LH/HEH1ɺH5 L LHHAT1ɦHmY^L9uHD$0HMmL9l$8LLl$0Ld$PLt$XHT$HH9t*AoL$hAoD$x@HEHmL`P@H9uHl$8H\$H@IHHtLC1ɺLH56  LC1ɺH5 @LC1ɺH5 蹥@HEL8 Ll$0Ld$PH5 LHH1Lt$XuLC1ɺH5n Ll$0Ld$PLt$X:LB1ɺmH56  LB1ɺZDLB1ɺ6H5 ɤLrB1ɺyfDH|$9Ht$1ɺLzLZL#B1ɺV7IEHp ID$Hx IEHx tIEHp0ID$Hx0zIEHx0tI$XAL$,1LA$AI$A$II$#)1ɿ1Lb H5 莣L}LXLVBII$1L4 IH5X @H11UXZqL@1ɺ]H5 LkL pL@1ɺUH5 跢0L*tXLLB@1ɺL/@1ɺH5 gIXI$XTL?1ɺUH5T /L?1ɺ]H53 &D@UHeSHH趞t H`u&HH[tJH[]fHHu˺LE?1ɿH5 股L?1ɿH5 YH[]ff.ATIU1SHt5HHLPHAE1j1j)H []A\@L>1ɺ"H5 Ѡ[]A\ATIUHSHH7t&LHHt []A\[]A\ff.AWLAVAUATIUSHXHdH%(HD$H1I9IL-i HL9t5HC@[tLHHM1ɺ>H5' 11۟HL9u˅AM$1L= DH5 藟LH 1EH5 sLl 1GH5 OL 11HH5v .I$M$L9I HL9H{H@t %ttA$=H{@L'HA$11H5 M$Lq 蔞HCY^H)1MA$Lc H5 MXZL;1ɺO1H5r 1(HL$HdH3 %(HX[]A\A]A^A_L;1ɺ"H5$ LHA)$A)$gCH{JfL9 1H5 |,?訔AWAVAUIHATUHSHLqHt$7)AuHLHHAFwHQRH[]A\A]A^A_DA@LH%LM9u*fM$$M9I\$C[tH H@@C^IL;t CYHe[tHٶ1ɺxH5y IL 1%1ɺHL;L91ɺ{H5/ 1L91ɺH5 ˛LKHq1L H5 蘛M$$M9LHAFHmu\LL$1L H5  gnL.1ɺH5 Ld$PLl$0H\$XWgOL1ɺH5 .gMLJ H5 gL1ɺOL1ɺt5H|$L Wt3L8 1pH5< AD$ fo|$ fot${3JHH|$(HtiH|$Hf.ATf1USHH`dH%(HD$X1H)$HD$Ho L$@HBHH5 HD$P1etLd$@HLauEHeCfHC CHL$XdH3 %(HuYH`[]A\@H|$ t$t$t$$$$H0HfoT$ fo\$0[HSHHHT$PHL$XLD$`LL$ht=)D$p)$)$)$)$)$)$)$dH%(HD$81H$HD$ HD$(HD$@HT$ HHD$8D$,0$$$/foD$ foL$0H HKHL$8dH3 %(u H[GAWfAAVH5 L˖ AUATUHSHdH%(H$1H|$jHL$b$@HL$ L$8)D$ H)\$L$(Hl)D$H)D$XHD$8HD$jHDŽ$HfDL$hMSHq3AWAV1ҾH EaHL$`H|$bLAźlH $[H $UM(1L=p3L H5 ADE1=AŅ$E1E1E1H\p3D\$LT$L(E8BHL PH L@PPH+ H5 P1ADl$ D\$0LT$(H Mt#D\$@LT$Xt$Xt$Xt$Xt$XH L@Dl$0\$4HD$0D$ HD$(foL$ HEMH$dH34%(H=H[]A\A]A^A_fnHD C$H>o3M11LT 2H5 Dl$ H|$@Ht$81H59 1t$8t$8#\$`LT$xH LT$H1MSLn3E1L 6H5 A_DAX PH5% 1R#AE1H EI:H5:LT$Hu# =LT$H= 3HAAEED\$I:1H5 L$L$D\$HfHBL$1H5[II:LT$aMLT$D\$$t0MZLLD\$LT$QCLT$D\$D$D\$LT$y$9nHm3RMGPL 1H5 XZLT$D\$DD\$LT$3:LT$D\$vE1D,$AHl3L08?A<$MH `H( HDHL=PHm H5I P1R.AH DI:1H5E1D\$LT$MLT$D\$$Hk3E1HHO`D\$H5֑ MLT$BLF P1AWY^LT$D\$fDD$@t$Xt$Xt$Xt$XsD$ Ld$HfoT$@D$PHD$PH UHEf.HIk3HLV9A1fUSH\$ x4H-k31ɿ1AL H5 U^8uH|$(H[];f.@H]8p=HL  PH PHF& LF;PH5 1H|$HH H[]O;ff.@ATIUHSH dH%(HD$1HHD$HtWE11LHH5 HHHtuHD$fo$HEHEHT$dH3%(uvH []A\L i31ɺ1L)H5 AH|$Ht HD$L i3L1ɺH5s Ae?DH(dH%(HD$1LD$@Mt*o1H$HGLHD$IHHT$dH3%(uH(>f.HH|$ Ht$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$H$HD$HD$ HD$ 0HD$$$$H HT$dH3%(uH>@HH|$ HtiH|$Hf.AWAVAUATI USLHdH%(H$1AA$H ?)AD$If)HcIt$Hc6IADž~jAD$DAD$~)MD$HcйH= It€A$)L-taA$AD${3t:Pv8 t3E1H$dH3 %(DucHĨ[]A\A]A^A_1LHHc?E11L1L t3_@AtA';fSHHt5xHt[@;ff.5@9uHuf.1ff.f@ # Huff.@ Huff.DD9}/HcЋTtҾDø@ D9}HcЋTt1fxNADt5ADAHcD)Tt҃A)xBøÐ"fpfAWAVAUE1ATIUSH(Ht$HT$LLE1E13HD$HH34DE11LA1\fD,AÅyEpA9t CDp -ELctBD΃E1HtHHUHAP tLcHuD9%Et E9L\$FL9IBA,AHHD$A!M@ȺA T9vEt\A,AfE t[L41ɺL a31H5, AMtHD$HtBLHE1tqH(L[]A\A]A^A_fA-AA1LE1uA9HA!EEMuHD$HtHL$H9HGHL$t$H|$IHL `31ɺ1LDH5U AH$H EG0EbH-S L% /HIL-b HHfHHHHH€tԹHL€tHL€tHLKOL <;31ɿLRH5c AHgHoH$ ?HHXHtKHIHt;H8t21E1LAEAD܅tILIu Nu1HW|fA,'FfANH _:3Aw0AW4HL$LGL =tL .HH=v-Ha Lp.La HL$H `.MIEHSAQA1R#WVH5b ASUAPLg QAMc7HPAugH$t\H$9tOuKID$(AOMH H HDHLPHRVH5L P1RGH 8HILJ9 MwAU1LP jPH5K 1ALKH"31AZ1A[kLK H5K H"3LM1LK lH5sK 1ID$PLIGPID$PFkA4IA09I`Ht.E1LQ H@HA$8E1Huff.fAUIATUHSHHdH%(HD$81&HHMyLAH%C0LH % ЉC4EH AAZYfADLHMM1MJLMMSL kGHH#H5HAUfATUSH25dH%(H$1)$)D$)D$ )D$0)D$@)D$P)D$`)D$pt72H$dH3 %(tHĘ[]A\A]f.v25 #HHHHHt$@@HASu%L%3La1ɺ8H5F A$H(25EtHfL%3H1L 1QH5_F A$@H9!|$@HD$@L E IDM$<$bLELR PHH5F P1AXZ2@L%3L*R 1.H5E A$D$@;ff.@Ht 1=15Hff.1L LQ 05Hp3H59E LHLD11A@ 05St!H=05)[H05a@=2tx 2H3HA8L WD 1PHIB LPH5D 1XZHFLH DFHHQ HDEHHQ HEȋFt`u@HLW3LV QRF8PF4P1WLNH5jQ AH0HDHLkQ QRWLNL3H5/Q 1AH HQLBQ RvWLN@QL3LU RF0PF,PF(PF$PF P1WLNH5P AH@Hff. fDHFtRH<\uWу0uOAAA0uDGEAA0uAHAD@AUIATMULSH@ǀkH?/H~G].5u=_2x|tH=HnH[]A\A]fD 2LHHH޿ 2yH=CHHƹH=2KfDH>/H2wH=`O T$ T$ HtHƹH=T2?ALH-O H߾1H1>/Hf22HLD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$IIHD$1HD$ HD$$ D$0HD$dH3%(uHHLL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$I$(HD$HD$ HD$D$0HD$dH3%(uHf.AUATUSHH $HH $HIAL$X!t@)$`!)$p!)$!)$!)$!)$!)$!)$!dH%(H$(!1H\$ LL$!H$"!HHD$H$0!D$(D$ 0HD$e~L 3IDLH 1AH$(!dH3%(uH![]A\A]ff.fAUATUSHH $HH $HIAL$P!L$X!t@)$`!)$p!)$!)$!)$!)$!)$!)$!dH%(H$(!1H\$ ILL$H$"!HHD$!H$0!D$ D$ 0HD$*~ L3I1DLpL1AH$(!dH3%(uH![]A\A]p߃A<v,G< v%H@H=K HHfATAUHSHH=(5Ht'HDHIup[]A\f11HHu(5HuH3H8rLtJ IH5I 11f.H3H(8*HIٺPLN 1H5I XZ1[]A\fDSWH'5H,)hH[AVAAUAH5CATE1UHSHdH%(HD$1|Ht-HHHL$1HH5t6HuBHL$dH3 %(DH[]A\A]A^fDD9,$uE1D9t$A@Hq3H8}IH H HDHLPHH5fH P1RdH W ff.AWAVAUATUSHH $H<$t$HT$HL$dH%(H$1=2u^t1E1L 3LoH H5G AH$dH3%(DH[]A\A]A^A_fDL$1H 72H-H LuLL- ,HHHD$ HD$fDHHHL`LLtչLH=tMH 2L1HCŃL31ɿ1ML~H5F AHHgfDE1H5H63H~8M1PH-CL5PH5BF 1XZlfDT$4$LHT$LHcƄ,ADžD$8%=@LHHfDHHLXLLtչLH=ztLH=(F tLH=&tLH=xiLH=nK H=H'L-H=pLH=E LH=hLH=LH=pL H=E LyH=D L[H=qnL= H=LH=D LH5D LL\$}L\$1MH ?2HlD LML\$|T$4$LL\$L\$H|$HT$LHAu%EHH 3H( 8b1MẾPH?H5B PL1Y^H} 3H8$MH H HDHE1PH9?LPH5jB 1RyH HT$H|$L$AH 3H(=8M1ɺPH>LPH5B 1AZA[L 3MW1ASL]G 1H5A AAXAYyfATA US1HdH%(HD$1f|$D$xwHt$߉LL 31EU SL}G H5'A AXZHL$dH3 %(H[]A\H 3H(8RAٹLsF P ATH5@ 1Y1^D8Hb 3H( u"HAٹ ATLXF fDAٹLF P ATDU1ɉ1S11HgxCHL 3A1S LF H5@ AXZH[]@H 3H8JAH5? PLCF 1 UY^1H[]fAWAVI1AUIH=KRATUSHdH%(HD$1Ld$ŅL9Ho|$ftߺM ADžf|$tHAL%3L;G P H5> 1A$1D1AYAZ11 DFP 1AWALF H5w> A$XZt L1ɺ 1H5O> A$E>A]@;8@ L%3I$nL F IH5= 1Ӊt L1ɺ 1H5= A$AE16L Y31LD H5= AAE1HL$dH3 %(BH[]A\A]A^A_f.L%3LD 1 H5 = A$7L%3LD 1 H5< A$E1fD\$zfL%3LD 1 H5< A$M4$8HELy= P H5m< 1A_DAX {`M4$8EH57< PLA 1SAY^=fATUSH0 2dH%(HD$(1x.h2xRHD$(dH3%(H0[]A\H11 22yHHtuHHHAHAąL 3LPD 1! H5>; AHHE22fDH31ɺ 1L)H5: L$D 1) H5: @2L q3 11LAC H5: A1HH5D%2L 31ɺ7 1LC H5F: ATHHH311LF H5: fUSH=M tI9 fDH|$HR2HHhHPPD$LHHT$C D$C$D$C(D$C,D$`C0D$pC4D$xC8$CLD$CH$HT$LHSHPHHH=)2HC@H5SHH=x6 fH([]A\A]A^A_fIvL$IMI9IA~uѐ_L52H2M>I9IvLt'DIMI9IvLIuLH=5 LD5 5 5`L5)2H"2M>I9uEDIMI91IIvLuLH=F5 ?Li5 [5 a5DLH=5 Lq@L 21L? H53 AH(1[]A\A]A^A_fD1E$E$$$^ff.H-2HtH8H2H?HH H5zHH2H0ff.H 2HH9tH2H2H9H2HtHHH2H8H AH5HH`2H0ff.=5DHH53 Mff.f5L> H5?2 DHH2D 5L1Aff.@H2D ^5LEt6A"1D ?5L> H51 AfL1> 1H51 Aff.5D=22DUSHHHt}(H+HC@C|C,HC0HC8HCHǃHǃǃHǃHH[]DLy21AL= <H50 AHH[]H1L /211LvBH5T0 A|ff.ATUSt[]A\IH5v1 HHtL2H1MS1L< H5/ AXZ[]A\ff.fAWAVAUATUSH(Ht$HT$DL$HIHD7HEHMID$HD$HE1D$1)fDM97G4AŅEHIELHAHH5\o t_L=2AH& L kLEȹ1OMAULU: SH5+ ALZYI$HHAHEHIٹWE1Lf2L: H5+ AL A21ɺB1LqH5k+ ADML9 E1QH5;+ AkDIٹGLD9 2f.AWAVAUATUSHH $HH $HD'dH%(H$!1IEuYLr2ILK9 gH5* AH$!dH3%(D.H![]A\A]A^A_Lt$ HHտLHAątiLHv A}/t/HLlM}L+ L2H5) 1E1APH$IH v2HD$HHw 1zHt$H$HD$HHD$H9$uHtzHsH{1HAH$MH 2HD$HH* 1c*Ht$LHD$HHD$fDH=2IHH$@L5 HD$L$@LH7LhLLtչLH=rt1MH 2LHu HT$L8xHD$H9$heHl$LHLH2H(8RL 21PH$LPH5' 1XZHl$>LW2M1L ) sH5{' AfLH!2IL( 1E1H55' DL2I1L( rH5' Akf.ML5 f.H28L#*=c2H H HDHL F2PHJ#PLH5v& 1RgAH ML' HML#81H5+& L 2PH"PL1AY^ff.fAVEAUIATIUHSHEMHHLHxiuHHHtH[]A\A]A^HHHuL A21Lk4 H5h% AH[]A\A]A^1H[]A\A]A^fAWAVAUATUSHHt$HL$dH%(H$1HHID'HEIHD$Ht$@DE1Ht$ Ht$jjPAQEAȉщH1\H8HE1E1Q1R1jjWj+H8fDHHE11RE11VHjjPjH8ff.t7HE1ɉjHjAPE1PHxPjH8@f.H2H5;)fH2@Ht?u2DH21fHu2@SHtfH^Hv8I1LR2L H5 A1[HHPH=2[ÐL 211ɺLiUH53 A1[fDH2@AWAVAUATUSL$HH $L9uHHt$IH5DH=|( dH%(H$P1HcIH$pH$0HD$HD$LH9H¾LHD$謢LL\$H H!%tDHJHDщ@HL)I9"HILLH|$HELL\$L\$LɨL虢LA苢tfD8H2L01A?MH H HDHLPH0H5 P1RAE1H C@H!2L: E1+H5G IHD$1AL̡LġLT$11LDM H5 AH|$AFM1ɺPH+0LPH5 1AAXAYLHT$VAefD1H72L H5j IHD$1AfME1L2L H5' AfDL\$EH2LC H5 IHD$1AL\$L蕦HD$HIͤ8&A>RPHPH PMLNH5 1AH :fDs8H2HD$L(贡A>MH XH HDHLPHH5 P1R7AH H2L\$HD$L(8BA>MH H( HDHL PHH5 P1R>AL\$8H M1ɺ9PHIL?PH5L 1AAZA[ H2H>8藠A>tSWPH-PH PML|NH5 1H VPHPH3QPHPHff.AWAVAUATUSHH $HAHIIκdH%(H$1HىAL-2u$LI1ɺj1H5A AU$H11IAWLo nH5 ATUAUAFH H$dH3%(uH[]A\A]A^A_葢A90tÐA9PuIHLLHUSHH $HdH%(H$1= 2u+1H$dH3 %(HĨ[]H$AA1H ɫ2H HExiHH޿8tH2H(>&I1PHe} L}PH5 1X1ZBL Q21ɺ 1L H5{ ADH`ff.AWAVAUATUSHH $HH $HdH%(H$ 1A|$t$H=Ht$D$u$L 2LF1ɺ~H5 ADL$AEt2H$ dH3%(DH []A\A]A^A_fDADH$HAŅtH$1H 2H Hd HIHHD$ L51 HD$L-L=2fLHL@LLtչLLt1ILHN HëSHT$H޿iql8qH 2L(貛1IٺPPHz H5% PL{1AYE1^3L 21ɺ61Ly H5 E1A@fE1L腠+H2HΝ8'VI1PH}LzPH5 1XZfD苝E18H&2H(ΚI1PH L1z<PH59 1_AX@L 21ɺF1L H5 E1Af.A蠝UHSHiHtLHHtHHqt HE~u1H'vH[]fDHp@L 12111LCH5T AH[]ATIUH SHtkHHt,LHH1vH߅@u[]A\L 2L H5 AL q2111LBH5 A[]A\fSd2[ff.HC=4u 5ǥ2u1Ht 2tދ21ff.ATUS1H dH%(HD$1D$f\$u%HL$dH3 %( H []A\ÐIFtHt$ ŅE$|$ Et'11 衘qA$|$ 蟹ŅHAL%2D$ H5 LN P1A$Y^Hl$fD 8|$ Hϛxۋt$ 耺fL y21ɺ 1L@H5 ADHLE2A1S L H5c A_AXߋt$ |@+jI,$視AٹL P H5 1SXZߋt$ 1豹,@H2H(8RLv PH5 1SDL$AY1AZjf.HU2=2Lt(Ll 1L H5o AfDL] 1N H5G Aff.2Du 1fHu 1H@HfDAWAVAUATUSHH $HL$ IHH$AEEHdH%(H$1K$u\L=21ɺ1L>H5g AD $H$dH3 %(DH[]A\A]A^A_fDDHAHH H ſHH HT$ D$8%=`AH9l$HsH%Hv2H$`He1D1HL$`HAHl$y舖8D11t$ DH}5IH$Lw 1BH5 AfIٹL L2H5 1AE1@$H2uH$IH$I1L .H5 1AfH$H(IٹL P5H5Y 1ATDřX1Z1E1fM)L H$H(8m$IٿH HO{ HDHLGPH H5 P1R>E1H K`AUATUSHH $HdH%(H$1H$IAHHuWL 21ɺMLp;H5: 1AH$dH3 %(HĨ[]A\A]HH[xDH2t!IL2 11RH5 H x7LIZ1L H5~ AFD{L8tMLY 11۹VH5@ AfAWAVAUATUSHH $HH $HHdH%(H$8!1H$0HIHHA蘻u\L 21ɺi1L9H5 AE1H$8!dH3 %(DHH![]A\A]A^A_L$0LL%tL|$LL輑A…u]D$(%=DT$ =`MxL LƼ2H5 1ADT$ @DL52LH膖6MH1IATL H5 AXZADXLH޿Аy g8tHL2I1ATL 1H5, AAY1AZHuAbDL52HI1ATL 1H5 A_AXLD$ $DT$ DT$ 轐8ML ~蓐M8HI1AUH5W L AYE1^fH$LDT$ &DT$ u$%Hź2DT$ H8a$0MH HCv HDHL;PH`l H5 P1RpDT$,H RfAWL=32AVAUATUSHHH 2dH%(HD$81L#L9<DkLHE@H= DCSHDS$Dk Hk)A(Ds4AC8GH2H$LH1IAVL H5 ARDT$$AUAH =J2tEDT$ Z}PL ;L$H5e 1Af.HLťI$M9t$DkLIHEH= -HD$8dH3%( HH[]A\A]A^A_DHF@H{@HfHDK0DC,HK(RDDA[]Zf.DHL$DHD$)D$H 62D$H $LA9AVI`PL# H5E 1AAYAZ1EEH ̗2H H=~4IANLl$ 1H4RL D$ 11H=44?Hcl$ LljD$ H谐DT$ H9+D躄2H$H(膌8߉LTi1PH L 41PH5F 1_AXfH舵AŅD1bLD,H$L(8QHI1PH LhPH5 1AXZ_L a2L21ɺ[H5 A/L$L211@H5^ AL f.H$L048荈}IH5zq H*HEHLfPHu H5 P1RCAH L3 &CfH$L(贊8 1H5 L 4P6HPL_g1AY^H$H(k8ć=4H5p HfHEHPHIL 4PLH5 1R,DT$,H e貊fSHHdH%(HD$1ou+HT$dH3%(uH[f.Ht$HLff.AWDAVAUATIUHSHXdH%(HD$H1=tD4DE.E,3A<$Ht$<LjDl$S9L 2L].1ɺh H5 AE,13@%fA$DžHL$HdH3 %(HX[]A\A]A^A_fD軆Hd28L; EL P AVH5} 1A_E $o AX1L HH5N AQXZ&DL 2LZ-1ɺj H5 AH- HAWAUASARAQE $t$8t$Ht$Xt$ht$xAPLY WVH5 QR PSU$P1H$ӸHĠH- |@H- l@H-3\@H- L@H- <@H- ,@H- @H-A @H-@H-qR@H- @H- @H- @H-} @H-u @H-s @H-n |@H- l@sH28L;EL P AVfDH-ld $߄ff.@USHdH%(HD$1u"HT$dH3%(H[]ÉitHt$ɪÅu+L l21ɺ 1L*H5 At$͢ÅuL02H1AU L@ H5J AXZRf.SHdH%(HD$1Ht$D$nHT$dH3%(uH[衃UHSHdH%(HD$1Ht$D$ÅtD$u+EHT$dH3%(uH[]fDE%DU1SHHHt(HkH{HCHCHHt HfDHH[]ff.ATHEHUHSHHt7H@ Ht.8thL2I11L H5 AHt0Ls2H1ISL 1H5 AXZH[]A\fH@Eu8u HtHUHHHSHHHtH@ Htt@HL2I1SLC 1H5. AXZHH[]fDH@H[]ff.fSHHHHD$ HtH@ Ht8tGLp2fI1ZD$ L H5 AD$ H[D@H[DAWAVAUATUHSHL LoLM9LAD#A#twf.+|IHP L9u0DA uE(HH] L9}HIP uH]L9thIH] D#A#uL9ZHC@D HEtA tHHE I9u{IHPfDLmE H[]A\A]A^A_fDA?t޺ LsoE;Wހ[yH b HcH>DEHL9tH DHu.u}uH] H[]A\A]A^A_E='^~t,E L9tHt1DP u2HL9t)Ht!#{@!փ@=@@uDž]EQ"uHSEL9C<"u/f.I9 BHڄw<"oHZ<\uI9zHBHHf]~%{}EH[EH}H]HCEL9S'ufD'HL9uHEHE HE HEHE L9YHMLfHXHDHڄt HZwHofAUATUSHH $HIHH$@H$HL$PL$Xt@)$`)$p)$)$)$)$)$)$dH%(H$(1Ld$H\$ IMHH$H$HD$H$0D$D$ 0HD$vL =H4$I}HHD17ÅuaL ʥ21L H5 AH<$vH$(dH3 %(H[]A\A]H<$BvH$HLHHD$H$0D$D$ 0HD$踈3L L 211H5M AJz@UHATSHH DdH%(HE1AtjEAAA}L2L 1QH5 AHMdH3 %(He[A\]ÐfZFH5 6ÅuL 1ɺA 15H5 ADL 21ɺC1LH5 A]DATIUSHH)Hs*HHt"HLHzDH[]A\L 21L H5[ AH[]A\ff.@AWAVIAUIATUSHHL$HLfLH MD$Hu <HEHIHHm{LeS(HCHH+L RLHLQ211H5 AXZH[]A\@HS HsEH{0HEH{aS(HCHH+LW RLHEpH{11IVsHEA$tj"H{@HH508CHHE[PSHu$L ]2Ln 1ɺH5 AsS(HCHH+L RLH@ELoH{1ItA $fZM{mS(HCHH+L RLHD@EHL1ɺHEHl{S(HCHH+L RLHS(HCHH+L RLHL 2L 1H5C Af.L L 211H5 AdHsRfDH[:fDHC"fDH+ fD1HL& [f.Ly1ɺL 2H5P 1ADL ٗ21ɺ1L9H5 1AwAVAUATIUSHHGHW HwH0L1ɺUHH{ S(HCHH+L RLHWL)21E1H5t AXZHL[]A\A]A^;HH{S(HCHH+L; RLHRL1ɺJHHHq{S(HCHH+L RLHM.fDH+}K8H{0LHOIH+CS(HCHH+Ld RLHkDLI1ɺPL ˕2H5 1E1Af HSfDS(HCHH+L^ RLH\?H; fDH#I${HC@tUH=IHI|$ t)L2I11L$ qH5O AMl$ fDHE1E1SIFS Iƃ HHMuIfHS{t]LHHu1ɺgE1L G2LH5 A HHD$SHD$aHfDL 21ɺa1LQH56 A HMH{0 IHt{uH2L1ɺH5 L1ɺn1H5 E1:HF21ɺ1LH5 볃1H2L" H5^ ff.AWIAVEAUIPATIUHSHHI}dH%(HD$81H4HIEL#HHC0Lc LcIL{C(Ds8WfH HD$(D$D$H$LHHtx{ uHT$1HUHfDHJHzHBHBHHt HfDHUHt$8dH34%(HH[]A\A]A^A_@H2L*1ɺH5 HE1L1ɺH5 1L q211ɺL H5 A1\HD2=gff.fSu+L 2ù1LU H5P A[ff.fATIUSHH5 H;"u6L 2Ź1L "H5 A[]A\@H;HHCHt4HsHHCHtH@Ht HSHLн[]A\ÐHCHu1UHAWAVAUATSHXuMdH%(HE1HQHcEIHӅ HMHN1D H9DL}ID$ HuDpL-H ALDADuHCHtHHt HSLLH;>MM4$#LcHLuHHHH%H)HHH9tHH$H9ut H)HLHT$H"I4$HzIHU_xHU H!%tDHrHD։"Hf 1LLHH5zMt$ MJ1LLHH5.[sI~EuA>t1LH5h H#LH0XA>~fDHL HCHtH@Ht HSLLMd$Mt EAf.HMdH3 %(DAHe[A\A]A^A_]"LaH!LaHL-ED1H5(HBHL$EEI|$1HڍH>H;D1LH5 HEL 1ɺ^D1LH5 HAttLHMvMtXA>tR1LH5 H>uEL1ɺL"2H5w 1ADMh1LH5) HELJ1ɺfDLHDL 21ɺ1L H5 AE1f1LH5 ) HllEL1ɺEL1ɺL82H5 ADM1MEL1ɺqljELl1ɺx봉ELY1ɺ롉ELF1ɺ뎉EL31ɺ|xEL1ɺ~bEL1ɺLEL1ɺ6EL1ɺ6EL1ɺ D`@AVAAUIH=o ATIUHSLH0dH%(HD$(1Ld$H$Hl$H\$Ht|LH1DH<$Åt2荘HL$(dH3 %(unH0[]A\A]A^f[L 211LH5 AL i21ɺ1LH5 AC_UHHHSHHtHP tVt9HL2I1S>L| 1H5O AXZH[]HzH[]1HzH[]AT1IUSHH@HdH%(HD$81HHT$HH{Ht@It$ H{HHE HtVHD$HHL$8dH3 %(uaH@[]A\L )211ɺLH5n A1fDL 2Lb1ɺH5@ A1]AVAUATUSHdH%(HD$1H$HIHIIH-; %fDH<$RXH[HtiH 1LHL&lxzHsH<$LHuHuL /2L1ɺH5v AH<$W1 DHL$dH3 %(ulH[]A\A]A^fDL ц211ɺL1H5 A1fDL 2L 1ɺH5 Amz\f.U(H=SHUHt0 HH耙HHtPHXHH[]f.L 211L iH5T AHH[]L 2L 1nH5# AHwDHwHGHCHtHGHGf.1ff.fHHw@HHHwE1H7HHHwAH@UHSH~HHt&HUHHHTt:HH[]L 211ɺLH5 AHH[]H1L 211LH5 Aff.I1Hf.I1H1ff.fHIо1f.HI11ff.fHE1HH5 HAHH5@HHfH1dH%(HD$81H)D$H|$1)$)D$ rHL$8dH3 %(uHH8YHHcHH5kHÐHHH5Of.HH52=ff.fHH5{ff.Ht7t1t@HHNH1ff.fHE1HH5gHAHH5D@HHcHH5HÐHHH5f.HH5rff.fHH5P[ff.SfHHHH@dH %(HL$81H)D$H|$1)$)D$ mHt8HP 1Ht uHtHRH\$8dH3%(u H@[Ð1WSfHHHH@dH %(HL$81H)D$H|$1)$)D$ Ht8HP 1Ht uHtHRHH\$8dH3%(u H@[1wVSfHHHH@dH %(HL$81H)D$H|$1)$)D$ MHt@HP 1Ht:tH\$8dH3%(u$H@[fHtHRHD1Uff.@SfHHHH@dH %(HL$81H)D$H|$1)$)D$ Ht0HP Ht'HtHHL$8dH3 %(uH@[@1OUff.@SfHHHH@dH %(HL$81H)D$H|$1)$)D$ Ht8H1Hz tH\$8dH3%(u H@[fDHtHՐ1THHf1HdH%(HD$81H)D$H|$1)$)D$ HHL$8dH3 %(uHHOTff.@HWHÔHtHAT{IUSHc}HLc[…!9]A\!fAUATUSHHH0IAHHH3HtLHEHC(Hs E(HtLHE HtUHsHtLwHEHt6EtHsHtDLUHEHtHH[]A\A]fDL }21ɺ`1LaH5F 1AfDL |211L MH5 AHH[]A\A]L |2L 1RH5 ANf.L Y|2Lb 1WH5 AfHSATI0UHSHDHHt,H}L耎HHtPHCHC H[]A\L {21L+ oH5 AH[]A\L {2L 1۹sH5 Aff.fH 鎎ff.HtwHtG1ff.fHGATUHSIHt>1Ht/HHHCH9uH3LH=&oHH9uL[]A\L z21ɺ1LH5 AfHWHt?H9u*@H9tHHBHufDHFHBHBHG1ÐAVAUATIUHSH:Ht}HHLITItT1HvLLJLLHI*It-LLHI1ɅuHJ4+LL)H1Ʌ[]A\A]A^@[]A\A]A^AWMAVIAUIATIUHSH(H?DL$ dH%(HD$1职HH}LH蹋HCHH}L蠋HCHfAoD$ H+H{HLl$CfAoNK(fAoV fCpL{xS8(H{XHAFAVLH}HH H HH%H кHD$tgA<$HL$dH3 %(HH([]A\A]A^A_fDL 9x211LA H5 A/L w2L8 H5 AH}H1ˇjfDH}HLQM5L w2L H5E AH}LH}H1ciMfAWIAVMAUAATAUSHLD$|HHHuKL w211L H5 AH%H[]A\A]A^A_DHŒtEH0ŅuZL1ɺL v2H59 1AfL yv21ɺ1LH5 1AkLH&ŅMH芊H|$H譈L IHudL u2H5 1AH,L u2L1ɺH5_ AH|$Pt8H`H|$HHT$PHHuL2 \ffDL1ɺff.fAW1AAVI1AUEL ATAUHSHHu2DL$ IRVH5 ZYyHDHH衐uMLt2I1E1L H5< AHV#HD[]A\A]A^A_@DHetH9+u$LNt2L1ɺ H5 AMtALHݿAątD$ uvH6.1AątDAfDH\IHs2I1E1Lu H5O DH*ff.AVAAUAATIUSCxHHH-uAL Bs211LR H5 AH![]A\A]A^DHtLH~(Ņu`L r21ɺ1LAH5u AL r2111LH5F A[]A\A]A^DDH,ŅtKfM1LJr2L H5 Aff.@ATAU SvHHH׍tSDHtDH(u$L q2L2 1ɺH5g AH+txH[]A\L q2L 1H5* AH1= H[]A\DL Yq211ɺLH5 AH[]A\fL )q2L1ɺH5 Af.AWAVEL AUAATAUHSHHp2D$X $1LL$ID$1R3VH5Y ZYuHHHH艄ADžuJI<1Llp2L H5 AHHD[]A\A]A^A_@DH uqL"p2I1E1L AH5 AHo2I1E1Le 6H5o oDDH譋tH&u$Lo2Lg1ɺFH5, A4$DHk"u$L`o2Lq 1ɺIH5 AT$Ht$PHADžu2L#o21ɺL1LH5 AH )ADžtQD$`uYHt$HTADžsL21ɺULn2H5X 1AHfDL1ɺOr렐HLun2A1hL H5 A1H@SHOHHbDK4DC0H. HHDHH1PxH[HfDL m211ɺLIH5} AHC[@AVAUIATUSHH0w40dH%(HD$(1HD$HD$ aHHL$HT$1HLL$ LD$H'Ld$MI H= LtoH(m2L(HHH5 ATILa 1E1AY^HHT$(dH3%(DH0[]A\A]A^ÐH|$ L3nAąu\L l21ɺ1LH59 A@L yl21ɺ1LH5 E1AmfHIl2Lt$ HL AVMMPL 1H5 AXAZHk2L% L(ADUHSHHHH8{HtHXHH H[]@L k2L H5, AH1[]HGHHWHH9u HH9tH;pu@UHHSHHTtH{XHDH[]DAUAATIUHSHHH8-~HHt5DhHx(L`4HH5HH[]A\A]L j21Lk M H5: AHH[]A\A]fATIUHSH?H }Ht)L`H{(HHh譾C []A\L j2L H5 A[1]A\f.AWIAVMAUEATAUSHHnHHH葅u]HA\ATL Li21H5) AXZH;E1>HHD[]A\A]A^A_DH;DEtH;Euyd#HAhATL L i2H5 A^_|D1ɺXE1L h2LCH5w A]@[ t_H;vHt$@H;tgHD$@A@9tkHAuPL2 DHAbATL fHAnATL HD$@@A9tHEzPL RH;=|H;I}H;IHT$HHSf.HWHHOHH9UHSHHH;rt]HH;XtHH9uH[]H;Zt2HH9uH{XHCXH9tH9ou %DH;otH?H9uH(fDH[]@UHSHHHHuHH[]醼fDHf2HHL TIH5^ 1H1[]ÐATIUSHHA$u@9uTH[]A\@Laf2HTH 1LLLw 1H5 AH[]A\@HHHL1H Lf2Lf HDLLPH5 1AXHZ[]A\@L e21ɺ1L!H5U A)ff.fAWIAVIAUATUSHHHw40dH%(H$81HD$ HD$(&HHL$HT$1HLL$(LD$ HLl$ MH=҆LL%d2M$1ɺH5 1LL$(L AHt$(1HT$0耤hHpA?H$0E1PAA>@HELݿ 1RH5 jP1A$H EH$0H84H$04@L%d2L- M$HLT$HAUI1LT$L H5g AXHZL1ɺ1H5C 1A$H$8dH3%(HH[]A\A]A^A_fHELɾ 1RH5 jP1A$H Et6A?H H s4HDȋ{01ŅEA>H H s4HDȋ{01JŅL)1ɺ1H5T A$mH$0E1PAfDL%qb21ɺ1LH5 A$@E1L1ɺH5 A$HfDLy1ɺ1H5 A$7fDUSHHN4V0 uBŋC4HLa2LKLf PC0H59 P1sAH H[]AWAVAULo(ATUSH8Lw(H4$dH%(HD$(1M9ELIMIH˺Hl$IWHH'/Hc;L1HH?H)H<$aC6Mm1M9AD$IuvHT$ T$ HTHc;LH TMMIHS HEH)1H<$ByL1ɺL P`2H5 1AAEHc;L1HpH)H<$B4Lv1ɺDAH\$(dH3%(DubH8[]A\A]A^A_É$L61ɺL_2H5\ AD $L 1ɺ9$L1ɺx5Hw1HAH AUUUUUUUUDAA33333333DAADAAAȉсUUUUUUUUʉ33333333ʉʉAAAADPHVH9t H*@ff.@AWE1AVAUATUSH8Dg dH%(HD$(1D$$D'I1GtDHIEEDChEmG! HD<NHA?DK8ANjCD$ 0H]2LLH$D$ nH D|tD$ HH H H1EH) ?KL$D$$1ɺr L L1H5 AaHD$HEL|$AL=L$L bL w H5` ALz HcD$$LH)I|v7|$ u01H >F D$$LD$$HH)I|DSttKh t4H D>K D$$LD$$HH)I|EE1fDAE9DHLsLI|DH)H 1>%D$$D$$Ht*1H =D$$LHc|$$H)LKht*1H =D$$LHc|$$H)L|$ u6v11H` {= D$$LHc|$$H)Lt*1H7 @=SD$$LHc|$$H)Lt4H DE1D=D$$LHc|$$H)L1DHV<HL$$LLHD$$ADžADHL$(dH3 %(D)H8[]A\A]A^A_f.fD DDDDChEkfDEHXY2H5 1LK IH$1ACHc|$$LDK8D$ D$ H)L0D$ f.LY1ɺ H$H5 1AHX2LLH$L= A9LI|H)HHs1L7yD$$LD$$HH)I|L1ɺ D1Hk 6DD$$LD$$HH)I| !1H x6vLY1ɺ D1H J6 L+1ɺ L1ɺ H$L11 H5% NL1ɺ yL1ɺ f1Hz 5D$$LHc|$$H)LL1ɺ $Lo1ɺ 1H e5D$$LHc|$$H)LL-1ɺ L1ɺ L1ɺ L1ɺ L1ɺ L1ɺ pL1ɺ ]L1ɺ JL1ɺ 7L1ɺ $Lo1ɺ L\1ɺ 'ff.AWAVAUATUSH(L5Q2H|$IdH%(H$1XL 1ɺF IH5+ 1ӿMVHD$HHD$H|$p0-mH\$L|$s4L0mtLÅ H|$HD$E1LHHD$L9HD$X4@0$\$H IHx AMD$D Hq HcH>DH|$I#L׬ O IH5 11H|$H$dH3%(&H([]A\A]A^A_H$IHD$XHD$`HHD$h6 L/1ɺ3 H5W AL1ɺ H57 1AL_ L1ɺ0 1H5 AL1ɺ^ 1H5 1Af.H$I@H9AIHHL$H$Ƅ$ L\$ L\$ E1MHHp HL11fAMwH MHHH HDATLϬ  PH5 AuAWD$,P1DL$0AAEHH0HLIUH|$MLjLM}MmL;l$ H|$uL 1ɺa H5s AHD$RH|$ÅHD$ǀMf.AL$I8LL\$ D$(AD$0A|D$4AD$8AxD$ HDH1'^_ÅAH /   w@/AII8HHcHM@1H)I<Hi'L1ɺ 1H5 AI@H$L\$ HdL\$  EEL8H= AH5 H EH IDEEpIDA|IDʅAxID҅H IDHWVQRPT$X1L$`t$dҋ|$hDD$l1҅L1҅H1҅L1EIH P1Ah%H@L1ɺ 1H5߮ AHc|$DH1HH)L%Le1ɺ fH$I8HHD$ L%1ɺ) H5M A3f.IL$HӰ LL\$ H41$L\$  L\$ 'GL\$ HHt*4$H^L\$ 2HL\$ L\$ HD$XH: MMI9s>L\$ HL PR 1H5 AHD$hIEAYAZL\$ AeAIHt!HrtHrHWHEAH5 ELH MHDHA HQILRH PAPAHP1#H04Lm1ɺa 1H5 A@L$IuHLLD$(LD$(J A}<AU@HHc|$DHRHL$0Hޮ H)DHPL1#A[Z L1ɺ q@Lɼ1ɺ DL1ɺ uDL1ɺH5 AL|1ɺ hLi1ɺ H5 ALL1ɺ 8L91ɺ H5a AL1ɺ Aul1D$(D$ DAEL H5 HD$PD$PH׳ LL 1ALAXAYfDƄ$L$)Iu`HL$L$0L L$0L DT$ HcD$PEHHH֬ AH)I<L1!& D$PHHcH)|$PLI}`t5L$1HL  D$PHHc|$PH)LAMh1H%  D$PHHc|$PEMlH)LEtDD$ E9AEt mL$(t*1HG D$PHHc|$PH)LAMp1H   HL$PHLLD$P HcD$PHH H)I<1L1ɺK 1H5٨ AL 1MHp1HLi1ɺ DL$IuPLL\$(L\$(L+1ɺ- H5S A9Iٹ6 1L H5. AfDLA1ɺY H5 ATfDH AHŨ EHMHLHEAHDA Hh QILPAPAHP1\H  HHHEH)I<AEAH= PAPAPAPAP1H0Lҷ1ɺv 1H5 ADL *s@A0HL$ IMHHob L1Å' HcHAp1H)HڮLV1AEtHHcH1H)L% AUtHHcH)I<ZH< 1ÅIHYHHHHDHcH)I<11HHAtHcAI<H)1iAtD t0IcHDL$ H H)I<1.DL$ A@IHHXHLl$ EfHC Ht,IcHL@H H)1HS LAH[HuLl$ HcHA|1H)H L A}HcD$PL  @LHt$HL\$ F{L\$ yHD$HHHD$XfDHcHA1H)Hi L AHcHI1H)HS L AHHcHA1H)H Lo\ A}HcHI1H)H L/d AHHcHA1H)H LH AHcHI1H)H| LAH!HcHA1H)H" Lo:AL91ɺ 1H5d A @H|$I[L I IH5+ 11=Lٲ1ɺ DL1ɺ H5 A3fDL1ɺf H5 AgfDLq1ɺ 1H5 AD@LI1ɺ 1H5t A@L!1ɺ H5I AfDL1ɺ H5! AfDHcHH 1H)LÅL1ɺ 1H5ؠ AfDLy1ɺ, 1H5 A@HcHAx1H)H LG\A=Hc|$PH1L$0H H)LL$0EIu`D$PD$PHL$L$0L{CL$0D$PL w@L1ɺ 1H5̟ At@Ly1ɺ8 1H5 AL@1Hɠ ZD$PHHc|$PH)LfL1ɺ6 1H5D A@L1ɺE 1H5 A@Lɯ1ɺ3 1H5 A@L1ɺ 1H5̞ A@HcHI1H)HQ LoAHHcHI 1H)H) L/fAHHl$H|$HuÅt7u$u0H|$I.#L\ 1ɺj IH5 1fH|$6HHD$L9HǀM&HML-i&H|$HIL AU{ H5 P1AWAH HHD$ HI.I\L IH5, 1LǀfDH|$E0EqHcHHǠ H)I<1ÅLL1ɺ 1H5 AWt$HLL\$ HL\$ 1HL$XHT$PHLL$hLD$`tHt$`L\$ HtH=YRXHD$XJ@HcHH 1H)L)AHXHD$X$fDH|$I.L T IH5 1f.L #L:1ɺ> 1H5e A L1ɺ 1H5A AL1ɺ 1H5 ALΫ1ɺ 1H5 AL1ɺ 1H5՚ A}L1ɺ 1H5 AYLb1ɺ; 1H5 A5DL91ɺ/ 1H5d A @HcHH( H)I<1 LAHfD1HLê1ɺ@ 1H5 AfDHcA4HH H)I<1ÅCLm1ɺ 1H5 A@LI1ɺk 1H5t A@IMx1H&D$PHHc|$PH)LL1ɺH H5 APL̩1ɺ 1H5 AL1ɺ 1H5Ә A{L1ɺ 1H5 AWL`1ɺ 1H5 A3L<1ɺ 1H5g AL1ɺC 1H5C AL1ɺ 1H5 ALШ1ɺ 1H5 AL1ɺ 1H5ח AL1ɺ 1H5 A[Ld1ɺ2 1H5 A7ǀM&HHHD$H|$dHE1HRL { PH5' 1AWAH 1H HAUtHcH)I<L1ɺ 1H5͖ AuH 1 ÅLf1ɺE 1H5 A9H 1K ÅjL*1ɺA 1H5U AL1ɺ; 1H51 AH|$/HIHRL { PH5 1AWAH uL1ɺJ 1H5ƕ AnHD$L- ǀL\1ɺM 1H5 A/L81ɺ> 1H5c A L1ɺC 1H5? ALl$ L11S H5 ALǥ1ɺO 1H5 A5DUH=SH7HHH<<HHtlHCHx`G}H{p>}H+=HǃHǃvHCHvHCHHH[]DL (21L hH5 AH7HH[]DL A(211۹L hH5˓ AHH[]wL '2LS H5 AH;16HH[]D}L '2L H5\ AH{vH;1V6Ht'SHHzvH{qvH;[(6ff.@HfHfHǀff.Hǀ ff.Hǀff.H@AUATUSHHDgpfA9tH|$H͔ @1fDXAV(s4{0HL$H-]#2A~Lew8$L1ɺI1H5؎ AL1ɺ1H5 E1UINMF @1H|$H ^QANH|$@1HГ =0ANH|$@1H ANEF@1H|$Hi H|$H @1DA~tYM6M9}ǃfDH-!"2L1)H5 Uf.HH%ADžL|$IN I9tH!2HHL$H(uHL$L IH5E 1QAWE1XZ$H w!2HL!H)H UAWIt1L H5 E1A_AXǃ H!2HH(ɲHL AWImH5 1AAYAZsH 2L GH-IqL-5 HE1ZHL UIH5% AV1AUAH H\ 2L H-L5 L-H3 2H-͐ L5L EnHԱHLĀ AUI91H5 AYEN1^ALˀ H5o U1ENL CH5I ULD 11DH5/ URH- L5L5 H- L5 L-H-L5 |L1ɺHGHGxDHt5HB`H`H9uHXtHH9tH;xu1HGHHHHH9utf.HH9tH;Pu1ff.@UHSHHHHH9t@HHx茶HEHH9tGHHHppHHH[]韲HtH[]1HtAWAVAUEATIHUSHHxHH4$L|$0DD$ LdH%(HD$h1HD$HD$H HD$ H%HD$(H H кHD$0tlIHEtKH<$LtdH|$HtH\$hdH3%(LXHx[]A\A]A^A_fDpltD$ AFlLH<$fAFpcuL(1ɺL 2H5N 1E1AnfHDHD$)D$0)D$@)D$PHD$ HD$(#Dd$Hl$LHT$(Ht$ E1LDL$ H謢L1ɺIHaDhlH<$H;AL$}HD$Htstml$ E1DAALHTHHHH  IHHD$AD9(wMRDI$LHpuL U2L1ɺH5 AHD$HL$ E1ɉH|$PDAWLD$8_AXL 2Lc1ɺH5 AL 21ɺ1L)H5] AHdH%(HD$1 HGt0ЉHH HH%H HH кH$~iHL$dH3 %(uH4@AWAVAUIATUSHdH%(H$1Ht>Iu8M}H$dH3 %(LHĸ[]A\A]A^A_HHjIHt0ML 1ɺYL2H54 1AD@HHD$VH$H-L I1IT$HT$MH,ÍPT$HH|$H#H\$ LM)HI}HBD$ AiIHt9L2H1IUiLz 1H5^ MAXZH$Ht$LH,$I}LHhIHt,ILz 1ɺufDD$MLz 1ɺy%DAWHAVEAUIATIHULSHHIܬHH;LIHtXIGPHHaAąL1ɺ L 2H5E 1AHD[]A\A]A^A_fDM L$z L]2H5 E1AfL 921ɺ 1LH5͂ E1ADH;LHt`IGHHHAątj1EAGI$LHpNt*D$MA$D$A$f.L1ɺL {2H5z 1AD.L%O2Lq H5y A$L1ɺ1H5y E1A$8HD$PHL$hADH|$HPAVL$ZYLL$X8L% 2LYq H5ey A$t@LL$XLq 1FH54y A$LHH|$HH25(LL$X1LHq @H5x A$H|$HHuAW4Eo0LL$XLkq MH5x A$L_1ɺR1H5x A$L螻H|$HH$脻$lL 1ɺR1H58x A$LLH|$HHLl$(H\$0l$8Ld$Ӄ$It?:Ld$l$81ɺcLl$(H\$0LH5w A$Hjt$(D$(P8H(HE1E1HwHHDHE1DHwщHH@AWIAVIAUATUSHH|$dH%(H$1HD$8D$$HD$8HD$fHt$H|$1HH#HIHHIHHH LLH蜐tHHB`H`H9uHH9H;XuHL$@HAt$1A|$jE1E1A\Z6l$@5D\$DE'vDT$$EWHDT$XMH{ Dd$\H5 2L{ LH5u L$(H ZD$,HEхH{ HE1RfP1ATARDT$8AH DT$HHDH}%M1H 2Ln nH5u H2D$\HW 2M麢LB{ PD$`H5t P1ZYD$$fDL1ɺuL  2H5t 1ADLQ1ɺzL 2L21ɺH5_t AwHkXHCXH9Ld$IFDLLHBt&H}H;tLH{HHmI9t;H}6HuL *2L1ɺH5s AHmI9uLd$\f.HD$8HPHt$H|$1HHuHHtLLLHnt1HtLLHuL1ɺ=f.I1ɺL J2H5r A[L1ɺL &2H5r AD$$H$dH3 %(D$$JHĸ[]A\A]A^A_L 2L:1ɺH5gr ADH"Htu$L2LZ1ɺsH5r A|$,t$(?H|uH HHt$p覶HAEfo$foD$pfo$CK(S8DKD$$Et DC EurH2HH(}Lj IH5Mq 1Ճ]Mi1Hw2Lj H5q LLHjD$$oL 72L1ɺH5p AHͻL2Lj 1ɺyH5p AHԻlL2L>j 1ɺvH5[p ACff.AWAVIAUATUSHH4$Ll$HHT$L$dH%(H$1H$HD$HD$HD$f1LLHHHHHCHIH_HH^HT$H4$H蝉tHL$PHu}jE1E1HAZA[LDL$PE^DD$`E|$tH5 L9H0Hw)8L$`Hu >HMH 2Lmu RD$|H5n P$P1LZ1ɺ(H5n 1H D$fL)1ɺL 2H5On 1AeDL~1ɺL y2L~1ɺH5n A'L~1ɺL ;2H5m AD$@H$dH3 %(D$H[]A\A]A^A_LM.IoXIXL9H\$8H$Ld$ IHl$Ll$0Ll$Lt$(HHHbt\I|$tIHHpxjE1E1LA[Z^D$Et$vM$$M9t@I|$HvL 2Lx}1ɺH5l AM$$M9uH\$8Ld$ Lt$(Ll$0HtHT$H4$H:HDCpLT$lt$hDH\T$TtD$Xt HHt9HHЅu$L @2L|1ɺPH5k A1H9D$HT$HH4$HiLZ|1ɺYfDD$lMLe !PD$pPL1H5Wk 1AY^D$cD$lMLe EPD$pPHi1Ld$ 11Lt$(Ll$0L{H5j DL$ED$lMLd 6H5j PD$pP1_AXD$H1Ld$ 1LK{Lt$(Ll$0H5pj Ld$ Ll$0MHLt$0PABH1Ld H5-j PABP1LL$ H )t$l|$h2Hmp t$l|$h<3DHcp #1DAWAVAUATUH-lzSHHhHt$Lt$HHT$dH%(HD$X1HD$H@1HLIHLHHT$Ht$H\t1LtHT$Ht$LXuD$$1ɺ L M1LyH5h AHL$XdH3 %(D$$ Hh[]A\A]A^A_DI1ɺL 1H5h A#HD$PD$$1HD$HH$D$ 1HLIHWA9ohuLHHT$Ht$HNtLRHD$H\IHD$PL%HK@H<$1H IHM9tLHMHLuID$ f.L1L2x1ɺH5_g ALL\$0LL$(ŵLL$(ALUEL\$0bIILJIGAGA O$HAW4Aw0MOEAIPAGpPIHPH t$$AA3AOD$$AW HT$Ht$LD$$L1Lw1ɺHH5?f AL y1Lv1ɺH5f AD$ |pML"1IHEop1Lwl HD$@AG4H5e ATPAG0P1LL$8L\$HAH L\$(HHt$HL\$0HD$( LL$(L\$0MMϹLL$L_ H5e L$AL0L$AE4HAL_ -PAE0H5d P1LL$8AH D$$L1Lju1ɺH5d ALLL\$0LL$(LL$(L\$0MMLu1ɺH5Ad L$ALRL$fLi1LM#Lj :IH5c 1AD$$l@LL$1L$LY^ MH5c AL$L1LSt1ɺH5c L\$(AML\$(LL\$0LL$(腮LL$(L\$0u1LL$0Lc1ɺL\$(H5#c ALL$0L\$(Ht$8LAL\$0LL$(HCLL$(L\$0LL$ML$MMf.AWAVAUATUSHH8H4$Hl$ HT$dH%(HD$(1D$HD$ D$D$@1HH{IHvAAE1I}HT$H4$/|t1Lq'E}EdAt ǃAE$uEEL"REEBAEA M$2HAU4Au0MMEAI}PAEpPIEHP衄H %Dd$Et+EEtEUEtEM EifEEDD$D$AE01LJHT$H4$LADžLoq1ɺ L 1H5` 1AL51MM11L[g VH5\` A1IHIuHwMM^LZ[ H5` AL+Lp1ɺ 1H5_ A@HL$(dH3 %(D"H8[]A\A]A^A_fL8L%1Lbp1ɺ H5_ A$HD$GL0p1ɺ H5X_ A$@|$t$tlKHH+tEL U11ɺ 1LoH5^ A1HT$dE1IuL A}AL趥MMoLY B@MMY1LYY H5=^ A*DH8D3@MMcLd fDLuL1ɺtH5] AL?IuL{D$dMMLGY H5~] Ac1HlCu%HHtH1HADžvAMDD$L%i1LM4$Lc IH5\ 1AH0D$uLm1ɺ H5\ A$]DHT$H4$1L L51LGm1ɺ H5t\ AHD$-Lm1ɺ H5>\ AADžLH7LH tALU `MMj1LFW H5[ ALHBL{l1ɺ" f.AVIAUIATIUSHdH%(HD$1HH$;f.HHt[LLHeu1Hu1LHRHHu1HL$dH3 %(ukH[]A\A]A^HA1HH(LV 1ɺ7 IH5Z 1ոfD뙐LLHnAUIHATUSHH诃HHH;LxIHt@HEPHH1ŅChADŽ$H[]A\A]fLY1M11LQ e H5Y AH[]A\A]DLj1ɺb L 11H5Y AH[]A\A]DLQj1ɺk HAQEE1HfDHAQA{HfDHHkHtHf.L Y1 Li1H5X A1HHH HtHf.L 1 L]i1H5X A1HHH諁HtHf.L 1 Lh1H5/X A1HSHLHtX8[DL A1Lh1ɺ H5W A1[AUIATIHULSLHHt11ɺ-1LfH5U ALe1H5T A1HAWAVIAUATIUH-] S1HL:H|$DH$HLAŅuH Hs] H|$L4}HAT$fAPhAT$P8IT$HIT$ @ HAT$(AT$4AT$0 IT$@PtHD[]A\A]A^A_f.L)1Ld1ɺNH5S AL1M1E1LZ PH5S AfHhfdH%(HD$X1HD$pH$HD$D$D$8L$D$(HD$HDD$LL$HD$@3HL$XdH3 %(uHhYfAWAVIAUATIUH-[ S1HL:H|$DH$HLAŅuH H[ H|$L4{HAT$APhAT$@ P8AT$AT$AoD$ AoL$0AoT$@Ao\$PAT$`AT$dAT$pAT$l IT$xPtHD[]A\A]A^A_fL1Lb1ɺH5Q AL1M1E1LX H5yQ AfAWAVAUATUSHHHHIII̓MHtvHtKHtEILM Lb111H5P AH[]A\A]A^A_fDHt$PH=T HHD؃$?$ vhHh D$LVM L111H5jP A^_fDILL .1LLLD$nyLD$HII<$LLD$,LD$HI@HLŅuVL`1ɺL !1H5O 1AHj@LAL D$@I<$LI8HHLYŅu{L`1ɺxL 11ɺ1L_H5-O 1A$MLQV LU1H5N 1AI<$LIGPH@HLŅDHD$`A_tH|$XALJtIHD$hI HD$pI(HD$xI0$ApHD$PII$Ht$X1H8dIHH@HL@ MAL ~8IPAtH@ H@HL@ MAH0L€tAMLJ MLJ jL/^1ɺ$9HAt H5`? AH[]A\A]DL 1111LOH5&? AH[]A\A]L a111ɺLOH5> AH[]A\A]DAUIATIUSHHdH%(H$1Ht>HuvH;I<$H訸HHLHLaÅWLkHI<$LHH$hÅZHuH让D$%=`2IL~= L7111H5= A-fL 111L= H5= AH$dH3 %((HĨ[]A\A]fDL 11ɺ1L!NH5U= AILRIIٹLE )LM1ɺL K1H5< 1A@DLM1ɺHT$(I<$E1E1LHHH  HH*L 11ɺ1L:MH5n< 1A详ff.@UHSHH{iHtvP v>L w111L; H5< AH[]f.HHsH;H1HeÅt:L 111ɺLiLH5; AH[]ÐL 11ɺ1L9LH5m; AbDHHff.fAWIAVAUAHATMUHSHH(LL$MdHH;LIIHtRH|$`HL 11ɺ&1L~KH5: AH([]A\A]A^A_fDM!1L1LB H5j: Af.L 11ɺ1L KH5=: 1AfDIHŅHD$`EoAoPAo` AH@0)d$IHD$`@8MAHD$IAǃDL 11ɺ)1L9JH5m9 ADUHSHHdH%(H$1HxmT$@u&H$dH3 %(HĨ[]D1Iٹ"L*1LD H5wD A1H 1H(Q8誟;IٿH OH HDHLPH~ H5D P1R1H B裢AUATUSHdH%(H$1?u/H$dH3 %(HĨ[]A\A]DIHHuuD$%=@tL-1M11LC .H5[C AUL_HHHu/H{/WHHtg}t޾H9y8uHuLG1ɺ=H5B AUHCI]NDLۥxHf.{8I]ugH1LvG1ɺfH5XB 1xf.LB 12H5&B AUI][}H HI HDHIPHL1PRPH5A 1H H7I]?fDLLF1ɺMDI]辜}H jH HDHIPHDLPR@^̟ff.AUIATL%UH-SH謚HHHأHHHH€tHƹLtH14taH91H聞8ڛMz1PH0L8{PH5d@ 1XZH[]A\A]ÐH߽ӠuH[]A\A]H11H8j1MqPHH5? PLz1Y^ff.USHHnH߉dt u觝H[]D H[]ff.@AVAAUIATUSH`dH%(HD$X1讚HD$AH$HD$1H豛)8 te t`tH-1L? 1H5> UӔuGHL$XdH3 %(}H`[]A\A]A^fDA~ę]cH]8踙M1PHkLyPH5B> 1X1ZvDH1H8jHML> P1H5= A]1A^'fD1躖Hl$ 2Lo A2H1IA$I!%tHDIT$LDII)LHIHL911͙߉1貙¸DH-18Le PH5< 1A_AXL藚Le81MPHUH5~< PLBw1AY^f.K8H-1ATM1AVL= H5)< UAYAZ\H-1LePHML< PH5; 1AA[A\踙H-a18LeHML< P胙8H-*1LeіHML< PNH-18Le蜖HML< P^əfAU1ATUHSH8dH%(HD$(1XÉH1$HD$HD$dx@ɐt&L N11ɺ1L?H5: A1f<$ukL%18M,$蹕HIP1L< H5B: AXZFt"L;?1ɺ1H5: A$f1HL$(dH3 %(u H8[]A\A]莘f.@1ffDATUSHPtEH1E1DH/H9HBAD$H<@IHHHPuH[]A\fD1H[]A\fDAWIAVAULoPATUSHG(LwPAĉD$ AM9t_I^InH9tIEtHC@) t IN(@HI~8uAF0tH{~HK9A}AHH9uM6M9uDt$ AEw(H[]A\A]A^A_H6H?QMt+MHMQMt }@tw1@ /@u&~ f(\fTхvf/1MI@1\fTf/fUHHSLH蜖¸t1HtHCHH8{H[]@~ f(\f(fTf/&f/иw?f/w1Af/w\fTf/Af/gpHH9t1MtI@H9fDH HH9r H;Nv1I;uHFI9Df/wBf/w4A\fTf/.A\F1fTf/D^f/8\fTf/vff/Vf/\ffTf/1MIPf/wf(\fTf/Vf/\1fTf/H HH9rH;Nj1M_IHH H9O1H;NÐf/V#ff/HH9t1I;1I;øfDHHpHHx鹓fHHHB@8AVAUATD`USLr(1Li(IHPHx IDj(Hp `t1HHH9tn@tNH9[]A\A]A^f.+t?@tOD[]A\A]A^f.H9[]A\A]A^@HCI9t*HV[]A\A]A^fD11랐SHwHHtH?{HCH{PHC@HK@H9tDPPHH9uK([ÐSHH@H2HH JuH[fDATUSHHG(u []A\HoPAHAuHC@HK@H9t&P(uցD t P(HH9uH{PH9tHGHOH9t;HPHt':t"HpV(tV(f.HH9uH?H9uQL T11L5 H5W A[1]A\ff.Ht#SH_H^u H[1[@1DAWAVIAUATIULSLH(L~H$L$ dH%(HD$1HD$M/Mu_IM/MtLL|H9uHHLɉuHL$dH3 %(L&H([]A\A]A^A_A$H$HLPHDl$ ILL$D;1LIDH0A҉Ņ~D;Ll$xDH1A$L V LKDmHIF`HHV LDʃtDH< PL,4 1H5GV AD;XZuE1fMT$:H8 PH5 V L_3 1AD;Y^A3ATIUHSHH>k1LHHHu.uHHHADHuI$H9E[HD]A\USHHt,H HHfHHtDZ uH[]HAWAVIAUAATUHHSHH]IHt:DEtDmtH=HLHI茇t(HH]Hu1MtM>H[]A\A]A^A_fMtK'IEH[]A\A]A^A_fAWAVAUATIUHSHLn8 uBL ÷1ù1L2 zH5^T AH[]A\A]A^A_fDH5#Ht1LHu?L X111L(2 H5S AHf.1H5 T HotH5/W HWtH+IHtID$(L5׶1IT$DH M>Z EtBHDK1HoLDPH5US 1AIT$ID$(M>_Z AXHx(tIHx8tBHDK1ɺHRH5S PL1AID$M>H YX Y^LH1ɺAUD 1LH5R AID$LH@ XZAt*HHxt;0uf;0t H Hxu1H-fDAVAAUAATA0UHSH?HHH|1EtoOdDcH}pIIAHA@ Ds,A0CCK(QHC HA H}@Dk(Au Hx H[]A\A]A^@HE`fH H[]A\A]A^@L Ѵ11L/ BH5sQ AH[]A\A]A^MH31L%1L/ H52Q A$1L01ɺGH5Q A$H}H14H[]A\A]A^AUAATUHSHL%'1uLg`HE@HM@H9uDHH99P,u9XuEH( u)U8D ru8PH(H[]A\A]@H[1ɺ%L1HL. H5;P ML1AH[]A\A]DEt/H[HA EH[]A\A]H[]A\A]ùH}H;L 1Lv/1ɺH5O A12fAWAVAUATUHSHH8LfPH4$L$$DD$ MIHE1fH臃H9HBAEH<@IHLHPuLkpI}t,@I}OHH9HBI I}uMHCpE1H$L5.1HD$HHD$IHl$mHpHT$HHHVHLAO MPH5N 1RQ1sHSDL$8AH0AEH@IHH$H{P3H|$MHHL`HݥMLDM9A?tI1ɺH5N 1AMMLWN 11H5M AL1ɺH5M DHH, PLN 1AQAZYt$$Mtb}tYL}LT$(L辁HMH5M VLM H5mM t$(L$ Q1)1RLT$HAMH D$ jKH**ʁ@t8vaHUM t'H4PtHS HeHEH5HM H M HDH5ŤHtɃ HOlHfeHEDLa+ 1ɺ1H5}L A@LopI}9H8[]A\A]A^A_fAVAUAATAUHH=1SLu`HLEDLH9HHBHiL B111LH5K AH5,1EDHH[]A\A]A^#L 1SH1LJoH5K 1A[ÐAW11L)L AVgAUATIH5jK UHSHH111L;L hH5M9wtH}H5{追tM&L@}H}LH衽uLM 1H5H LI 1ɺ1H5H H-I1LI 1ɺH5H 1LI 1ɺH5H 1L 1L%I Mt8HHu1Mປ1H59H LMY^MuLƟ1ɺ1H5H H-}1L) 1ɺH5G 1L V1L%I Mt:f.HHu1M1ɿH5G LMXZMuL HL/1[]A\H5wG A]1A^A_AH}H5J H}ʼALIL@t<HgG t'HFJtHeH_HEHLG 1PH5F 1AwI AVDL$(AH}LH A?:LE1ɺ1H5F Ht HfH2_HEiL( H5EF LNJ 1H5'F Cff.@AWIAVAUATIUSHXH?Ht$ HT$(LD$DL$@[HLII<$pH5L' IIEHDIFH<@HxL/( IHI<$EH|$H_ZyHD$8II9c1Ld$0L<$AD|$@D$Ll$Hl$DHEH9$DHsET$H@M,IuEuHHt$xHt$HHHD$0H8>ET$D9T$DD$ImAED$fML$$Lt$LmI L1H5>D 1AI<$L1ZLBxHX[]A\A]A^A_ÐL I111L& H5C AHL$ H{HIEHD$(L(fDHD$0Ld$8DT$Ht$H8L9D$DT$ImAEAEAD-D$|@L HHHpI<$HL$ HIEHImH{EIwHEHD$(L(Ll$Hl$DDLd$0H LE11ۺv{LLt$ML$$AI7EGIAT$LHIFIT$HPIE9D$@tI4$HHt$vHt$HHH$H8EGE9DD$tJH$HT$8Ht$H8̶IDD$LHIF\$8HhjMILt$L$$IEILHhI<$H57E bL1LF H5A AVfD1E1L 1L$ H5[A AL1LHF H5-A A@I<$蒶HL$(IEL)HL$ HfLl$HLd$0LE HD$8HHD$1ML$$Lt$ff.HAVAAUMATIUSHwHHuffD9.tL@H HsHtKuƒtDtMLD&t[]A\A]A^@Hvf.[1]A\A]A^1fU(SH^HHt6HnktHH[]@H{OHH[]DL ٢11L" RH5{? AHH[]ff.fAUIATIUSHH(qt3LgsHLHhHEx1҅uH<+Lp1҅H[]A\A]ff.@AWAVIAUIATIUSHxVdH%(HD$h1ƒtfL 111L? qH5> AHL$hdH3 %(Hx[]A\A]A^A_@H^L~I9LHLItHL9uAT$t@@@I]I9u HL9tMD$HCI9uH,L{ L ,1uMN`pMAP`@(H<H%ML9@(vV===L# LL111H5I= AEDw uI@M?LPHL|$`HD$M;Mvr ;L? (\H^L~L9oLHLmHL9u`@ `uL;|$M9 2I@LLD$H8LD$A@ @D…%D1fLI1A11L. ,H5; ADI?1@I@H0 `L h!DI@MLxHLT$`HD$MlMG  h0La f.IHL$` Z1L;|$tn E1HL$` L\$ILT$_LT$MN L\$1M92L;|$1M9!IHL$`  1L;|$E1HL$` L\$ILT$hLT$M L\$1M9I@HHD$@ƁL ڜ111L  H5u9 AqI@ALxD$`MwA8vn zZL U t`M|L;T$1M9! `uf/w&f(\f(fT cf/f/_\ SfT;f/a1Zf.!fD1 1L;|$`HLL;xu0LHHduH\$l$ Lt$(Ld$8Ll$@HD$HHD$H9D$vH\$l$ Lt$(Ld$8Ll$@H|$LD$IOLD$LYHMHL$A@H1%@D$0Ht$ H9L|$Lt$HLd$PH\$8Hl$@Ll$XM@L9%HD$ E1HT$(AAH@HHD$qeDHT$(MHI݉fDHLH;ju%HD$H|$2HH0cEDDAVII9s‰DLMHD$ HHD$ H9D$OH\$8l$@Lt$HLd$PLl$Xf/~fw*f(~X%`\f(fTf/Jf(f/\fTT1L;|$H\$8l$@Lt$HLd$PLl$X=1L;|$1L;|$\ ٷfT1f/1L;T$1L;T$f/V1f/f(\fTp,1L;T$YLD$Ll$0H\$l$ A@Ld$(%@D$0YhA@%@D$0BDAVIAUIATIUHS袥Ht"HI9tUHLLL)$HCHuFL 411L , H5. A[1]A\A]A^H`HCHLZ[]A\A]A^ff.AWAVAUATUSHG(€W(uH[]A\A]A^A_DHH?HÅ^H]@Le@L9{HE1HcHHD9LOL9uIL`IH L=?/ U@K1LLLAsHcSH}LZ)HLWt{HL9C)uC,Hא1uHU`CH@HLL0E(uH}1LulL 1L H54- AHu0H}1蹡nrL @1L H5, ADL 1L 1IH5, ADH_IH@H}H5/ #u?wL 1L7 H5\, AL1n`H}H}跡Lp11L7IHú}1H5, AH}H޻*L`DU1E1L 1L3 H5+ A_L 1LQ 1dH5+ A1hL 1LA H5f+ Aff.fAWAVIAUATUHSHHHL%1P,uLg`HHt HR:sDk(A LeAHHH@L-,, 8_fI9sHLL)MAąhH;L2H;H5bLeL"-bH;HHuL1AąLV hDxP(EwMc`8L\HH1MEDH9* LHoH;IcHY4L H;H5p$LL /L 1H5Y) 1E1AHD[]A\A]A^A_fDH;L1˝AąxDk(1AAFHA]fD@H@HI|a4L IHSHsH;1PAąL 9L ͋1H5( 1AL\LT$ ZT$ HHt IDIH;1ҋ@H@HIt賜H;H5藜sH;H5p~{WH;H5_;IDk(L mL Њ1H5' 1A*f.HHZH@8MH;H5+ߛ1L f1L? H5' AHE1%[LH;1H苛AąutL ?:fDL`YHH1MEDH' LHWlxsH;IcH%-Dk(Z@LZH;H5) GLc AąDk(AI%fL L H1H5% 1AfL DL zWfH;H59 LL ӈ1L H5% AhL af.Li +LS [H;H58 谙AąNL MXff.@AUIATUSHHH>uQ?DL%,1u(I]HH[]A\A]; tH;t1҉HL3tDt 8uQf8tDHuL 11L% H5,$ AH1[]A\A]I]HHC[]A\A]DHIE11L(LGIwNI:LAI9tt<_uIAAI9uHHtD@HL11L$ jH5O# A1HE1@AWIAVAUATUSHXT$AH|$dH%(HD$H1HD$ H$,u@IA,t LHEt<,uHL)H+PLD$@-H$1L%څ1I|$PHD$LE1Lh "DAFH<@IHLHPsH4$HLtDD$L$DH|$,IAHL$HdH3 %(HX[]A\A]A^A_DH-11H|$1ҾnLTy11H5! UH1AWAٹL~ H5s! UX1ZkD$@IHsHH-1L 1FH5*! URIHsD$fDH-A11ɺK1LH5 UDHD$L``I|$PtgHH LhhE11HL$AFH@IHI|Pt9I|HT$H4$&tDD$L$1DH|$zIYH-1@AWI1AVAUIHHATUSHHLD$H\$HdH%(HD$81H-S1H}PMe HE1!@AFH<@IHHHPHLH\tHD$E7AHL$8dH3 %(DHH[]A\A]A^A_fDD$L111LH5M ADL$Im`H}Pt`Me E1Mmh1!fDAFH@IHH|PaI|LHAtHD$E7A1E1)XAWAVAUATUSHHH|$T$0dH%(H$1HD$\HD$HD$XHD$ HD$`HD$(<,uH<,tIf.IAt<,uLH)ILt$LD$HHHL$ L|$0T$\t$XPH vAFH\H1 HL$ ЉALKH$dH3 %(HĘ[]A\A]A^A_@1H|$1ҾL%111LtjH5F A$Hk1SAL H5  A$X1ZefH5aHVHuD$ID$4HD$HT$(L1LLppLl$(AUI!%tDIULDHD$(II)I~L$4H\$HLMHl$8IŃL|$@L$4@|$4t; L$H H{tXHkHLPLHLxIL'UuM9tK|=H5JUuIM9tH H{uHl$8L|$@H\$Ht$7L$0HD$tA|$ x@H|$1,HfDHt$HV` HP`E1HzPHDt$Ll$$fDAD$IH@HHHxPbD0t11DLHIU`Lt$Mn LOD$4IAFD$MEȉL$ Sf.AWAVAUI͹ATIH=~1UHSHHt$dH%(H$1HDŽ$HDŽ$=2=H|$HD$HHDŽ$HHDŽ$wIƄNMHD$ HfHBu _t-u IAuM9GLH$LLL)L$L$>$$H@HID$`HD$0H$1LH=}1D$H$HZD$%D$HUHD$0DxD$fD$t AOAGAH$HD$@Au'H$AHDHD$@f.I$$AHL$(HD$XL$(HHD$8%I$D$HDŽ$0HDŽ$pH<"A<'9L$0A DT$PH$pLHD$(HHSHDT$PE#fD;2H HSHtAtL$0L$pD1M)HLſHtIH$0H$H$pH$Ag|$%A EljD$HD$(D |$H$H|$(LD$y$LD$HEH$D$L50z1HD$(H$HD$ uMt$`IL$@It$@H9uH H9t;Q,uAA9uH@HIDHD$D$#A(I$HL$8LD$0H8ԌLD$0HL$8HII$HL$8LD$0H8蟌LD$0HL$8HHIFHƨI$HT$HHL$8H8LD$0LHT$HLD$0HHL$8HBD$IAFL[uM[L$p t1I$DLL$pH0AӅL$pLD$(L+D$ D$IxLD$GLD$HH$p Ht$ LHLD$RLD$H$pBI$I^H8{HH$pHIFH8I$H8HHLsHuLfHuH$1L*)HH@H$ HH=w1 HuH$H=w1ݾ5MtHI}LH$dH3<%(HHĸ[]A\A]A^A_DAA1LyL-w111LTkH5 AUMLH5 1AUAL 16H5[ LL$AU71L H53 AUHD$1HE fDHuL$H=pv1L訽H$1HL'HHtHHu LH=)v1dD H$HuUHu1HD$0@$AA1LL-u111LiH5D AUMLLau1LML OH5 AMt+HI}LHLH$HI$H8IHupfDAI$LM1L-t1Ls H5S AUfLyt1LMLy _H5 AL$0L$pDM)uDA@@hA{ AH|$@H|$8 @"1ɀ'H$H$A HHD$(HH$H$H|$XH)gIH9HfDŽ$$H$H$H$H$$HD$ $IHDPH$pL HHD$PFH$pI?-@HL)HJ!HU!Hb#LdHHHHHL'IHHIIAH HqI&H JcDH9R۸$DAlAD$D$fIHHHD$ HDPHt$PLǺ LD$8EH$pLD$8H?:HL)HO"H#"H!HAdD$HHIHHIHA'IHIHHRI<H<3$D$${\$HHH"H|$ H1HDr@+@- HAHt$PHϺ HL$8DH$pHL$8I?:HH)HHLdHHIH<IIiHkHc$@$<$DHHHu ;t$<Lt$@1H|$ DD$ALL$0 <'6 11H|$8H$H$A $0KL$HD$(HHD$0L-Ln1 LLHH5 1AUHDŽ$L1ɺ$1H5 AU=fDA  H|$8H$H$蜴HD$8HHD$88% H|$@H|$8H$pH$01XHL$@HH A@H$pHD$8D |$AD|$HD$81E1H$HD$(HL-!m1@H$HD$@6fD+([}{H$HxA H$HD$(HHD$(L$1E1HD$@H$ A@~4AADARAxA 1"'H$H$1HA HD$(HL$1E1H$HD$@XL-k1L 1HDŽ$H5: AUDI$xDLLD$訵LD$HH DH@HAA D$ADHL$8HyL-j1LL$1L H5 AUL:1ɺ+1H5v AU>@Lj1LML VH5A A I$Ht$ LL\$(H83}L\$(HIH$p D$%@vn=O==L-i1LL$1LS?H5 AUfDI$LH8yK uMFMHIIt ISI@HI$LH8dyr|$IL$AN_fD$%=D$IE1AFd$@]4fDI$LM1L-h1LH5 AUfDL-h1LL$1L~ H5A AUL-uh1EKRM]HHgh1LHL1 H5 A[L %h11ɺ/1LH5 AHD$0 L-g1LDLH1H5 AUL711H5s HDŽ$AUDH|$@p H|$X HDŽ$HDŽ$0EwIHH豻H\$8AGH$pHHL$PH=]g1HH$舮_<" <' 1H|$8H$0H$A HD$8H5 H$0H$LH|$X- L-f1L1ɺ_ H5E AUHD$0HXHD$8H|$XLH$MvIٹ L9 @n)dH|$@HD$@0I$HT$8HL$0H84yHT$8HL$0HHBL-e1LL$1L H5n AUEL-e1 KRHIT$`M]H(L I HP LDHLRd 1H5 AA_LEXLL$ 1H5 AU>I$L.L-d11L] H5 AUH|$@qHD$@D$IAFID$`LHAL-d1LL$1L H5% AUHD$8L-Kd1LL$1L H5 AUNHD$0 L-d1LLHMIFIHISH@HH|$@ HD$@E1DI$HIFHɿ(1L-{c1LtH5) AUIFMy LISH@HIVMIH"IKHBHIVM AiACHBVHƄ$0%A^HD$8Q=DHD$8xLPfH$\$(L$0LHD$ M蘩"1ɀ'Ht$ A LHHHZHT$P H=Ib1HH~ H\$8\$(9 L b1Mt';b1tHb1DH;XtLMuL-a11L H5RAUHD$0HXH"AWSH$0H$LH|$X$H$p?IH\$0LT$1L-a1L H5HIAULT$LT$8gfDI$LM1L-`1LH5`AUL-`11LP H51AUHD$8H$HD$0HXL !H (LDHLR` L-`1HL-`11Ly1ɺ H5AUH|$XLoHD$0HXIL A@[HD$@HJL-_1LL$1L H5;AUL-o_1LL$1L H5AUrL-;_1 L1H5AUHD$0HX.H$H$HxHD$(HH$H$H|$XH)qIH]41 LH=6HYHL$@HAHAL-p^11ɺ 1LH5AULi1& H5AUHDŽ$L-^11ɺ 1LuH5AUHD$8AGAu1DAGH$0H$LH|$X(l L-]111ɺ LH5>AUHD$0HXH|$@o H|$@INHG?Ht HAHWHI$E1DW"81L- ]1L:H5AU"L-\1LT1ɺ H5AUHD$0HXAGHD$8L$H$HD$@L8MH\$0[ L-|\1LH5*HIAUHD$0L-R\1HL )LHMUSA PLEʃ H51AHDŽ$_AXHD$0L-[1 LLHL-[11ɺ 1L3H5xAU^LHWH)HXHD$ HDPHL)HDŽ$LDŽ$葢HHT$ LL$0LL$1HLb5HT$ ;"2INff/f/YE1DI$,HHL-Z1L$p1LxH5[AUHD$0L-Z1HL aL%HA MUASLEP 2LD$ LL$/LL$ 1HL1LD$ IHu ;" I^E1 DI$H#'L$pWLE1LɺI$DLL$LL$ 1L-Y1LH5FAUHT$ LL$.LL$1HL3HT$ ;"UH|$@%HD$@INHHtfH*YYE1DI$@D$D$L-X1LbH5wAUL-X11ɺ%1LH5FAUF1L#H5 AUV.AuLdHHHLHHHJ 1L-W1LH5AUL)AHWI)HD$ HDPILHD$ HWHDPH)HAAE 1L-tW1LH5"AUKL-VW1LGt HA+ 1L-W1LH5AUH.E1D$8uL-V1APt$L$LH51AUAYAZHt$PH$H$)H|$P{#$tH-T$8+$HL$@HH)I)HYLqL-MV1L1ɺq ];"RH\$8ML-V1L81z HH5SAUY^LH|$Xe HOHt$P LD$`HHL$8X)HL$8LD$`H$pIHH)ȹII)Iڀ?-/JL)IHIAH  1L-HU1LH5AU 1L-U1LH5AUHt$PH LD$ |(H$pLD$ HH$1L_Ht$P LT$pLHL$hLD$`L\$8'(L\$8H$pILT$pLD$`HL)H)Iʀ?:HL$hJL)IpHe1D$HH$pHD$8AGv AGLIH?H7H<Ht$ <#Ht$ HHID$H HHI9uHH (L1Ll$ IHHHtLHA9wHLLl$ H:$L-NS1H\$8z LH5AUHD$0HXH\$0HD$81L-S1Lt H5HIAUg 1L-R1LH5vAU 1L-R1L<H5IAUr> 1L-nR1LH5AUEHcHAdHIH+$@&INHЃfHH H*XL-Q11ɺ31LIH5AUCL-Q1L 1L H5YAUALdHHIIL_Ht$P 1LLD$pLL$hLT$`L\$8$L\$8LT$`HHLL$hH$pLD$ppHL)H)HLHL)dL-P1ASt$LL$I$HT$HHL$8H8LD$0cHT$HLD$0HHL$8HBD$3IAFL-oP1S t$L|L$L_Ht$P LT$xLLL$pHL$hLD$`L\$8#L\$8LD$`HHHL$hH$pLL$pLT$xeHL)H)HLHL)| 1L-O1LH5kAUHȾdD$HHH1IHHID$H1E15 1L-RO1LH5AU)HAHIH H\$8lH\$8L-O1 L1H5AUHD$0HXZL-N1Ls L-N1L AVIAUIATI1UHSHdH%(HD$1H$iHHuHHH=jN1襕tQMtlHI|$菢H4$LHL}HHL$dH3 %(Hu_H[]A\A]A^f.MtHI|$L;fIH8|IHtLu1#AVAAUATIUHSHHdH%(HD$1HHsHtH;:]HHCAMtA<$tH5?rLu&HL$dH3 %(DH[]A\A]A^fHE1DpH8襩HHtHHLH,HH<$ړ8IHAHXrH?_IHHt(H=ASZIEH L%?L1H51L:A$HHt H}[Lp1ɺ1H5A$HHE1H8[DL K1L*1ɺH5hAfL-K11LH5;AU1MLH5AU1LMH5AUA#!SHH?H2]HtHCHC [fVL J1LH5A1[DHF IHHAHPHF IHHE1H3AUI ATUHSHH?Lc"]ILHtgH}HZHHt=1DHH߾ ,x`LeIm I]H[]A\A]@LYNL I11H5AH1[]A\A]f.E1SLI1L3H5CAH1[]A\A]HHQ0AUI ATUHSHH?D"|\fLHtgH}HXHHt=1DHH߾ t+x`DHEIm I]H[]A\A]ÐLkL H11H5fAH1[]A\A]f.E1pLzH1LkH5#AH1[]A\A]AUI ATUHSHH?Lc"l[LCHtgH}HWHHt=1DHH߾ d*x`LeIm I]H[]A\A]@LL G11H5VAH1[]A\A]f.E1LjG1LH5AH1[]A\A]AUIATUHSHH?L"\ZLHtgH}HVHHt=1LHH߾T)x`LeIm I]H[]A\A]@L1L F11H5FAH1[]A\A]f.M1LZF1L H5AH1[]A\A]HwHtHW H9tfHw HG@( tHE1L1ɺH5L1AfSHHHtH8tTHHt裔H;[TH[rfAWAVMAUATEUHSHHxH$H|$HL$ H~H V-HD$(H$dH%(HD$h1Ht&131H @0 H HxuH HyuʾHT$HT$HIHD$HtAGIWxADA G(Mw0Io`I_pAG(A tAYEt AG(tAG(IG@HHD$ΘIPŘAwIpxH8HtHPH8HHDIW (H=\9%RIH)IO`1ۀyHQpu T@HH`HszuHHSIGhH=HD$1SL4H5UXL-Z11ɺnH5cU1Ht$dH34%(ueH([]A\A]A^A_E1IG@L9t(L$T$ DHL9t9H,u9PuH(H1L(f*^XUSH HnHGf* Yх~/w( p\ʁ/wH[]H([]fD^ 0H([]ff.AVIAUATIUHSH?MhLHIc$HHH}LIHA<$HLZLx HLL[]A\A]A^@H}HL{LL <11H52A[1]A\A]A^HLH50[]A\A]A^H}H$LuL떐HtW1HtPH9tVH}fH*HxOfH*^Y,t=D@f.f.HfHH H*XDHfHH H*XnfSHHHHtH[΋fD?HT$H4$UH4$HT$HHHuL ;11L@ H5AH1[ff.HHt1DAT1UHSHE@HM@H9tfPPHH9uH]PLePM(I9u[l@HpHt HSHHS8C0Ht'HBLExHHHu@H@HH:1PPHL9tHHu벻[]A\@L 9111L<H5wA[]A\ÐAVH3H-IAUATIUSH\$8Hl$@t$Ht$8H91Y^IHtHt;uIDž[L]A\A]A^fDHHEHH6DAAt ApH HBHD AuËH@HLHtAtAuH81HHPAɺ 1LH5HXZ1LH5*[L]A\A]A^IH5^HtIH=Ht/HLMAE%A$L1VL 7111L1,&H5AILAM(L[]A\A]A^DH71L1 H53L a71Lʳ1ɺ-H5ALE1i@G( u%SHu H[C uH[2ff.HHP/HfAWAVAUATUSHH(HHt Hx?HkPHAą[C(HHt HP:uC( BLs@HC@H$I9AF)Av,L-761uLk`H;FC(0LkPI9ufMmI9I}ZIHtHPHpH2tVL越LHuHs0H;1FuL 51L]H52AfDH;GH(D[]A\A]A^A_fDC(@uHxf.HAHtH0H蟊LsPHD$IHD$I9tAN0u I~8H;EHHt H@8@M~IFM/HD$L91IUML;l$tIIWB)ut/HH;Ht H@8Hs01ErIWIwH蚥C(@uL$M $IUL;l$uHH;HtLH@8uC1H55EH;L;t$t#1H5|YE!H;f.H5DwH;EHE1IHk31HH$L(tLGH$HRDJ AHL11AWLpH5AXZC(@7Lt$II9HD$@DG EuH H@0HxwH;L-21L1H5ZAUL1ɺ1H5:E1AU DH`H;H2BIHHKPH9y1DDADzK H H9uLDH htcH[E|O,@IIuH虆IEM9uHHV^HoC(.71H5QWBtH;1H5%B3LF'H;H5qBH-11H;L(bCL1ɺIH51AM6L;4$fDLx8LH;HpI DIHLHǾ=HL-01H@(x t'L $1ɺ1LQH56AUM11L.H5AUML1ɺH51AUH;L@HkPH\fH#HL؄AFH;1H@HIt0AHs0H;1@L /1LH54AH;1H5@M~IFHD$M/I96LkPI9#I}藄HMmI9u@0tjL-.1L$1H5AU6L,L .1H5e1AH;A2fH;HvHH0DL-a.1L1H5AU<L (.1LH5ADH.111LaH5LL1ɺH51`HH p1 H'DL--1L1ɺH58AUfDLL P-1H5E1ALLOYGL ,1LPH5A|L ,1LH5APL ,1LH5UA$LeAAWAVAUATUSH(H4$H-HAHͅuHHuCLL +,11H5A1H([]A\A]A^A_fC)tH([]A\A]A^A_fDH;@?IHH{I\$C)ID$HHD$L{@HC@AD$0HD$L9Dl$MH;(>IHAE,AEL5T+1 H=L@IMIBH€uM|$8Mo HH=˄€rLLCxLH3HARP4H|$L9MmL;l$FDl$HHtqHpHthHT$HcuWAD$0IT$8Ht5HBLCxLHH3@H@HHi*1PPID$8H@@)tC(@DEH@s8H;HI=ID$(HNL )1LCH5A~fHC IE Ls`MoH<$PHAULRIMAJHIB@ILLLe)1H51A1HtAT$0UH;L$'9$LfL9f.AEH@HIDZf.L (1Lb1H5kANAELH@HMLH{PL|C(tHfAD$0EYH(H[]A\A]A^A_mHtAD$0EE-ff.f1ɺGkATAH=US5HtW(HH:HHtwD L`HhL{@H:HHL3|H[]A\L a'111LH5AH[]A\DL )'1L1H5AH15H[]A\DL &1LH5AHAUATIUH@SHHH9IHHhHtE(AE LHCH{I]Me8H9uHH9t HxuIE(Lz *uMMtIELHx8IE8HIUHB(ڃB(H[]A\A]fL %11ɺ~1L)H5nALzH{L5H1[]A\A]fIUHBHH9tHxHH9umH-H%11LrH5UL11sH5UXfIEHt]P( ⿉P(fL $11L[H5kAH1[]A\A]MIE(DH ELy$111ɺ*L L2H5AlIED@ Eu Hx 3uMt'IELHx.lAM0*IE(H-#1Hx(LUIUx DJ At=H1ɺGHIH5xPLRa1AIELUY^DH AHH1ɿH<LaPH531AIE@ XZM3H-R#1L˼H5UL1ɺ{1H5UnH-#1Lz1ɺ@H5UL1CH5Aff.H>UHSHgHH,U1C0<H{8tEHSHLX"1H5 L_B HDH1J H Q1AY^HC(Hx8tLHx(tEHSHL"1L_H5B HDH1J H wQ1AXZc0HvHCHtS HǀP(HC(Ht@ H}Hu1H[]fL a!11LCH5AH1[]fDAULoATIUSHHGH(I9u<]DHxHt*ÅL(ÅtRHUHL9t&HHx(u@ HUHL9ufA<$tdH[]A\A]L1ɺL { 11H5)AH[]A\A]DL1ɺAD$ u I|$ -qL & 111LQuH5AAl$ H[]A\A]ff.@USHHtH1H{@s.H[]f.7H@u!IHHHHOr@t*HHP@-uքtҀ-urHH@uHff.@AWAVAUATU1SHt~HIDnA;@ugH;@tZ?uIL;Et))HH L;HEtHBDz tAHEI9t;HA@uH[]A\A]A^A_D@HATIMUSuUMtPHLHtuH0I$HHHEHHH{[]A\ÐLcL 11H5A[1]A\I$HukL 1LH5A[1]A\fLhff.fSHHHL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$IIHD$HD$ HH$D$0HD$Gx'HcH9ںCHL$dH3 %(uH[øS/HNHxHH[HEff.AWAVIAUATUSHH8H|$H4$dH%(HD$(1HHIŻHl$E1A4DLAGEILcLIIHAAoIFLIL$HLEHEA9sA-HD$L(AGHL$(dH3 %(u@H8[]A\A]A^A_fLHT$LHHt3,@f{t1H|$dH3<%(4H([]A\A]fHt$HH9\$t1 HD$GD$HxLfH*\'8fT 8f/vfH\$EHU'HHfHH H*XfHtHH]f(7fT 7f/H@Hd @H@H@ff@nfDHYHI>fDHƤ~)@BfDfDA4$Dʚ;fDfH*Y ˅f/s H,\H,H?D;X{NrAWHMAVAUAATAUHH5 1SHL$H\$0HDL$dH<%(H$x1HD$/HH!HNIƋD$MH8H1BHH(s 9HuH$89H$P9H$h9HH AH}ARsIDD$EDHfH*I91fL1҃HIǃwH9wL 1HRHD@HBt 1S@$HRHHL0MfI*^QLVLHf(XZH$xdH3<%(LHĈ[]A\A]A^A_HH1HxD8)Hu1HD8*HuMH8BIH fHHuHHt'HHD$1HT$H5JeAǃH-b 11ɺn1L…H5UL ԲH1SLH5ZUXZI$E1HT$dH3%(DH([]A\A]A^A_fH-1LB1ɺiH51UL rfDHLHL$HI H)LHIF(HD$LpHcIF0HHIvIV(IVHIN MNH5ϱ1_AXH-11ɺ1LtH5?UL H1SLH5 UYL^LDH-1L1ɺxH5ְUL H-y1L1ɺrfDH-Y1Lƒ1ɺuH5UL BH*HAHHD$LD$H!L)LLD$HLD$HIF8bHIN1LH5uH-1L 1ɺH5ѯ1UL fM4$I^I;^VHcT$1ɍBHfDIv0<a@ƃH@pD$܅A9N  In8H5HtH5HHI^H-1L21ɺ =HHtHIV@H5c1v L H-o1|H-c1Ĺ1ɺH5UL L5DAWAVIAUATIUHSH(dH%(HD$1;HtnH5HHHt7IHT$dH3%(H([]A\A]A^A_DH5YHiHt<L 111ɺLH5A1fDHD$HKHPHC(HSPHC`LK PHCXLCPHCPH5%PHCHPHC@PHC8PHC0PHC P1HP HIHD$E12DHKhLIHAD9|${ LH=It LH==HKhH4LHCxHtcLFIHtNHLIHt;DCpLDDD$ IHtDD$ HKx1LD9Cp1IXL1LH5AHLI1 LH=_uHKh@ LH=DuHKh@LH='HKh]1HSpH54L"HcCpLIHHLL)HHHH1LH55HcuqH5LQHtH5L6HyI.1L:1L6H5iA\H4LOHHLIHHLkHH1H9DAUIATI UHSHHHHHLHHL@H51LCuI]H[]A\A]f.M1vL1LsH5IAHHH1[]A\A]@L 011ɺoLA|H5 AH1[]A\A]DAVIAUATIUHSH oVdH%(HD$1)$HIHHHHM1H5L7tZ1ML,0LH5[AHH1HT$dH3%(ukH []A\A]A^@<$-uBHCIL 011ɺL){H5A1fD11L4HCfUfSHdH%(HD$1FF F0Ht^HH5H Ht'K8HT$dH3%(H[]H5HHtIHlL9uLH|$MIIwl$E1HD$IHuvf.IOLE1ɾH H1ɺHID9vA|IIFM9uHt$H|$L,HD$H>LT$HL$LS8HyHqLS0_CHHt$$D$$C HLsLH HCHs H|$HHC(H:Ht$H1SDSE8fDs H{0HHHs H{0Hk@L@|HPHuMfDHI9cs H{0g|HEHuH-g0L]1ɺH5^UL]1ɺ1H5?UH|$H1 HL$(dH3 %(HUH8[]A\A]A^A_s H{0{ID$8Hs H{0{ID$@HC9HSs H{0L${ID$0HuH-0L\1ɺmH5~UL\1ɺ1H5_UfDmL /0L]H5-A@H- 0Lr\1ɺoH5Uf.H-0LB\1ɺqH5ЌUMD$E1DHSDL4AMnM~QH !HcH>Iu0IF0HxHHIu8IF8HxHHAE$AF$AxqlK E1AuZf.AD;k sFDIV8DDLXMHPIE1E1HXHHR AAtDLHu1ɺIE1H0LTH5LtT1ɺ0H51HHL$(dH3 %(D=H8[]A\A]A^A_IH3H,$LD$HD$HD$ADžueL ~01ɺ81LSH5sAmf.L I01ɺ-1LSH5>E1A=fE1DHD$HHPLpHT$HT$HPHD$MAFMnAIFAID1IuLI1AM9uy茬f.ffHHt'tuHtHuf.ff.@9USHwSHHHu2fw3HHt!H[Hm ;Mt1H[]f uL u(L 01ɺ1L!RH5AH{GuHupHuH{CtHuH{2u1fAWEAVIAUIATUHDSHHHA9w!_HCEHDCHA9tQ;uA9w#DHEEHDEAHD9s }u1H[]A\A]A^A_rD9uEu,אEtHEHSEHESHEEHHAtu'EuEH{HuHE{HEu u uvI]I.gff.@AUATUSHLgHO L9A4$HI\$FfG1H_HHH誠HEHH[]A\A]fH_1GHHHjHEHH[]A\A]fwH_H[]A\A]fH_GHHHHE`H[]A\A]@HGHxHA|$^(11LU L9 1A]ub5D-?HEHHAʃHHEEAыA A!ɅEDDI9N]Hs\uSHrtenDEAHDH9L 0LI1H5AEH[]A\A]H}E1H]HH肞A $HH5|A1H[]A\DL'HLHH|L?iHEHRHsEHxHEHEHHާHfDC+?*tV|XHIHDH;HHHhHL`H[]A\f.H;HHtNHhHH@@H;HHtHhHH@o@LI1ɺeL 011H5S{AH[]A\LiI1ɺ|HLDLII1ɺ4ATUSHHHt{|tH[]A\fDHHIHt`H;HHtHhHL`H[]A\DL Y01ɺ1LHH5z1AfDL )011LzH5PzAJAWAVAUATUHSH8dH%(HD$(1>fIH|HIHvHcHL>LH1ɺBHHCHHsLL~LG1ɺEHHCHL|$ Lt$H{HALL;u HC8Lt$HLL|$ IFHD$DHHhHD$H]HEIFoAoHANoP AV oX0A^0H@@IF@IGo A'ohAoop Aw ox0A0H@@IG@A$fHL$(dH3 %(HH8[]A\A]A^A_f.;LF1ɺ<HHCHtQH@L|F1ɺ1HHCHt)HsLLHHCHuLGF1ɺ4L 0H5 x1ACHsH{E1LLJq;uUHC8uLHPHHSHPHPHSHPHCHPHHSHPHPHSHPHC@Lt$ HLL|$IFHD$XHH|HXHD$HEIGoAoHAOoP AW oX0A_0H@@IG@IFo A&ohAnop Av ox0A~0H@@IF@L 01ɺ1LDH5vA`AVI(AUATIUHSHdH%(HD$1mHH(HIcLvHIEHtsMe LLd$MuLLuHHu;@D$tRHLHD$HHuLuL z0H5u1ALHNHL$dH3 %(Hu=H[]A\A]A^fDL 101ɺ}1LCH5bu1A fUHHSHHؗHHHH[]sHGHtStKHLDHVHHHt;rvHHHuÐH@Ht H9uH@ ff.AWIAVIAUATIUSH_HHGIAnfDHX;(r HXHHuAfD(HEt A.HXIAAI(HuL 011ɺ[HLBH5uAH1[]A\A]A^A_@HXH@Hi4L` H[]A\A]A^A_Hff.@ATAUHShHHtD HhH[]A\ÐL 01ɺm1LiAH5JuALvIrE1MI)H9t't'8u#tH8LuA L9utAIAtA1ICD ff.H9tw?ou6ILvI)fDtH:LuA L9ut??ou7H)LufDtH8LuA H9u1tÐ11H HADøLufLuIeE1MI)@H9t+t+8u'@tH8LuA L9utAI AtA1KRADff.ATUHSH9tCIHU1H0fD0HHHH PI9tHHDVu[1]A\1[HM]A\ff.fH9tBUHSHHHH fHH9tHDQ tH9źHDH[]1fDH9t6UHSHH蚓HH fHH9t HDQ uH[]HÐHHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$IIHD$HD$ $D$0HD$HD$dH3%(uH]ff.fAWIAVAUIATIUHSHL7L$LLL$rHt]HLHLAAńt'LHHEHD[]A\A]A^A_fDH$H|$H5`q1H$H|$1E1H5q@H9tGH)L0H1HAULkH5hAX1ZH[]@DKAQeL0h1Lbhh(H5,hAAY1AZ'tDLM0Q1RH5gLjAY1^t.HLDG1DH‰ Љ1I9u@tV‰ ‰1Ѝ 1Љff.fAWAAVAUATUSHHG D#GGN,I]HtYAAHt$HMIHE Ht4D9cuD9suH|$HsLt%IHEE HuHL[]A\A]A^A_ÃEDAUIATAUI|$ SHVHHtHxLL诌DcHH[]A\A]ff.fATIU1SIT$ HLpLIDhHU #EHHIL[E]A\A]A^[1]A\A]A^DAUAATIUHHSHH^Hu }ED@LHHt HHtH@H[]A\A]fAUAATIUHSHHH~Hs {ED@LHuHtH8HtHH~+H[]A\A]ff.@AWE1AVIAUIATUSHHH~ALhfHS #CL$‰I$HD$Ht[9ku HT$HsLu AMMDIHHuMt#IHtH@H[]A\A]A^A_H1[]A\A]A^A_ff.@fAUIATE1UHSHfIU DHHtHHxHHuAE9esH[]A\A]f.SHtCH{ 1PHXyCHC [ÐHFHFHw OHtfHu ЃH9sff.HHtOV!ʃ9rHw Hu߉ЃH9sDHH?@H?tHGH>HFHGH0HwPH Gc$H5bH=byff.@HHtHH~HpH7PH b3H5bH=byDHHGHBHff.fUHHSHHHHH[]'1H9?1H9~f1H9>SH1҅uHH[DSH1҅uHSH[@SH1҅uHSH[@SH1҅uHH[DH1H9tfHH9u@ff.@USHH?tnH>HtFHHtH[]ÐHCHUHH(HHPHUHHCHEH[]H *aH5`H= awH aH5`H=`wATDbUSA9tp)HHLH֍qHHLHH<d}1rEHUHEHDHH)r1H4 9r[]A\fDutEt1fDEDDHH9t[LQ`8wLIc L>LHEEt4DE8YpHyE8\9)HA9wH@HxL/wHHHH9uÐLHA tDE:YDQIHyE8\9HL9uLHHH)EYL9iEt5>A8yWES1|HA:| 4I9uLLM@H@H<>LHHAL9HID9f.HHID fDHHID 11ff.AUATUHSH^HwIHcH>L&I\$IHL9t_Ct{HHu1H[]A\A]ÐHt/LE1DHHL8HpetAD;+rH[]A\A]HEHHH[1]1A\A]fDL&11HI $UkA|$It$ H6>HfHE13LctDHHL8HpAD;+rFfDH 3LcE1DHHL8HplAD;+rfDAWAVAUATUHH]SHHcH>Ht7LcE1DHHL8HpAA9rՃwHHlPHHHHD[EguH[]A\A]A^A_@L6E1I^MDAHL9w{tHHu1H[]A\A]A^A_H6>HH,1H^H;qH H=^F|H1[]A\A]A^A_DHt;LcE1DHHL8HpX_AA9rՃHHDTEdPHHHTHDJE?ufL.E1E1AEMuIRfDIHAHHI I 8HpAEII9'A/w9rH%,(H=[H{1 DEH[]A\A]A^A_H6E~H5DH,ѾH]H81 p1fH,H=[Hz1fHq, H=ZHPz1VfAD9Amt+11ۉLHIHP0A;]rLxp[]A\A]A^I]M1HS3LHnI9uHGHtH LHGIuHtH IUAuL.Lhp[]A\A]A^IUAu Lo[]A\A]A^AmJ11ۉLHIDHP0A;]rAm11ۉLHIDHP0A;]r1ff.fAWAVAUATIUSHH(H9t%HHVHcH>tjLD$tH1Ht$oLD$HSLZA$H([]A\A]A^A_fH)IͅLCA$H([]A\A]A^A_ULnHHATHUHItttAEz9LCafHvH(H[]HA\A]A^A_fLnE}EAU8UIII)E9EBEAQH@HCAt@8tu HAH9uDLD$HHL$H)DL$YsDL$HL$HILD$E)ItHxLD$DxDHL$DL$pAoeDL$HTLD$HL$LLA&AEMuEM5LD$lD$LnAEOHHUItmtIAMuHAt AUDLnAEHHUIt%u1fLnAE0HHUItAUMAT AU\DLFNDAϿLD$IwqI1MLD$EnI~LAHMFtLsA$LD$HL$WqHL$LD$HIfoiV1@@@$@4@D@T@d@t1AtAD6AoTHAHHuEHUILADZD$LjD$LsfLD$HL$GpHL$LD$HIAEHUIvXLAFAoeEAfAomAn(Aou(Av8Ao}8AFA~HD$CLiD$LsLD$HL$oHL$LD$HI11HpIUHMfLnEtEA/vfD1H[]A\A]A^A_'uH^HGH3HtH oCHEdH[]A\A]A^A_LfHSHIt'wHATuA<$WA$0wHUHLD$D$HUHLD$HMeHSLlDHHAtAUD9AUHUHLD$D$lfHMeHSLLDHA|AUD9wstQAUn1E11E1fDHE1H=JL5Jg3t(BL#L1HI]D9#wHE1H=qJgDl$ At&DDHAHHDHP0D;#rH[]A\A]A^A_HE1H=?JL5-J%gIIt*B|#/wDLH1IR\IuֺHH=IfhDl$ E11ADHPHtHDHAHHTD;#rH[]A\A]A^A_fHE1H=kILc0fML=)I@AIAAEtDLH1N[@HHH[HH]1A\A]A^A_![H HHH1[DsH[AD$ EL*H E1H=XHLk`eDKEt0DHAALH-H1ZD;srHH=GeD3H[cfHE1H=GL5GdDEt&DBL#L1HIZD9#wHE1H=qGdDl$ ;A"DDHAHHDHP0D;#rH[]A\A]A^A_HHH= G+dDl$ A IL9A4$tIT$DHH 2DH5EH=FYf.AWAVAUATUHSH6H9$HHCHcH>HMeHSLtyDHELEuAUD9AUDH[]A\A]A^A_@LeHHAttHHSIt7H1[]A\A]A^A_fDLmEtEA/wAMHSHLtDHHA|SIAD0IU /w A8s HH9uAUDLD$mAEPAUHUHLJD$LeHIt$?E\$EI$ELD$HUZD$@LeII)ET$E9EBEt6AD$8_Aq1THA:TAUHUHLD$7D$j1E11E1I}DD$AUDLAUD$LD$WED$I}DD$VAUDLBAUD$@UH(SHHUHt@HhHX H[]DSHWHw H[VfATIUHSHHfMHHH[]A\QSHHHwHHu[Ã+[ff.SHHwHHdH %(HL$1LD$HHD$5D$t)HL$dH3 %(uH[0[UHHSH1H9t []t!uH@HHEf.H@HE뽐UHHSHHG8H9tMt H[]@L@H)A;Xst,AH8 uDK1fDAtH@:4 uI9uHHHp[]SHwHHdH%(HD$1HT$D$t DD$D9uHL$dH3 %(u,H[DH,H>H81Q1Yf.HHWw1HHHactivate/activate.c%s-%s-missing_%u_0No host tag matches %stpoolvpoolrealGetting driver versionGetting target version for %sFound %s target v%u.%u.%u./usr/sbin/modprobe%smodule/dm_%sModule directory %s exists.kvdodm-%s (no device driver)Logical volume %s in use.idleCounted %d open LVs in VG %s.Found active component LV %s.UnmonitoredMonitored%s %s for events [Test mode: skipping this]Not mSkipping %smonitor of %s.%s%s already monitored.Monitoring %s with %s.%s%s already not monitored.Not monitoring %s with %s%s (reverting) pool only thin only if activeSkipping: Resuming %s%s%s.Resuming LV %s%s%s%s.resumed temporary noscanSkipping: Activating %s.Activating %s%s%s%s%s.LV %s is already active. origin without snapshotsSkipping: Suspending %s%s.already suspendedRequiring flush for LV %s.suspend_lvssuspendinglv_list alloc failed.failed suspendSkipping: Deactivating %s.deactivatingdeactivatedFound active holder LV %s.locking for suspendunlocking on resumeunlocking on revert%s configuration setting defined: Checking the list to match %s.No item supplied in %s configuration setting matches %s.Ignoring invalid string in config file %s.Ignoring empty string in config file %s.Ignoring empty tag in config file %sactivation/volume_list configuration setting not defined: Checking only host tags for %s.module string allocation failedsnap_seg module string allocation failedactivation/auto_activation_volume_list configuration setting not defined: All logical volumes will be auto-activated.Activation enabled. Device-mapper kernel driver will be used.WARNING: Activation disabled. No device-mapper interaction will be attempted.Activation disabled. No device-mapper interaction will be attempted.Failed to get %s target versionmodule_present module name too long: %sInternal error: Target present version called when activation is disabled.Cannot determine activation status of %s%s.Found suspended LV %s in critical section().Found suspended layered LV %s in critical section().Snapshot merge is in progress, querying status of %s instead.Logical volume %s is used by another device.Logical volume %s contains a filesystem in use.Retrying open_count check for %s.Checking transient status for LV %s.Checking snapshot percent for LV %s.Checking mirror percent for LV %s.Checking raid data offset and dev sectors for LV %s/%sChecking raid device health for LV %s.Checking raid device count for LV %s/%sChecking raid mismatch count for LV %s.Checking raid sync_action for LV %s.Thin pool data or metadata volume must be specified. (E.g. "%s_tdata")%s must be a RAID logical volume to perform this action.Unable to send message to an inactive logical volume.Kernel driver does not support this action: %s"%s" is not a supported sync operation.%s state is currently "%s". Unable to switch to "%s".Internal error: Cannot check status for unused cache pool %s.Cannot check status for deleted cache volume %s.Counted %d active LVs in VG %sRAID module does not support RAID4. Cache pool activation for clearing only.Skipping unmonitor of opened %s (open:%d)Skipping monitor of snapshot larger then origin %s.WARNING: Failed to %smonitor %s.WARNING: %s: segment unmonitoring failed.WARNING: %s: %s segment monitoring function failed.%s %smonitoring still pending: waiting...WARNING: %sonitoring %s failed.No degraded or partial activation for raid with integrity.Refusing activation of partial LV %s. Use '--activationmode partial' to override.Refusing activation of partial LV %s. Try '--activationmode degraded'.Cannot use partial or degraded activation with writecache.Refusing activation of LV %s containing an unrecognised segment.Refusing activation of RAID LV %s with visible SubLVs.Internal error: LV %s missing from preload metadata.Internal error: LV %s (%s) missing from preload metadata.Not activating %s since it does not pass activation filter.LV %s has open %d snapshot(s), not deactivating.Failed to remove temporary SubLVs from %sDeactivated volume is still %s present.Releasing activation in critical section.Activation of logical volume %s is prohibited while logical volume %s is active.Cannot deactivate logical volume %s.Cannot deactivate subvolume %s of logical volume %s.cache/lvmcache.clvmcache %s: now in VG %s %sNo size for %s./dev/mdnot chosenis inis not inis nothashas nois used foris not used forof previous preferencedevice is used by LVdevice size is correctdevice name matches previousdevice has fs mounteddevice is in dm subsystemdevice is in subsystemdevice was seen firstlvmcache label scan beginResolving duplicate devicesPV %s: %s %s dm. %s %s dm.PV %s: %s %s LV. %s %s LV.Adding chosen duplicate %slvmcache label scan doneno longerDestroy lvmcache content#orphans_lvm2PV %s size is zero.Found PVID %s on %sAdding pvid to hash failed %sdevice is an md componentdevice is partitioneddevice has a signaturedevice is missing sysfs infodevice type is unknowndevice is not in devices filedevice is not in devices listdevice is an LVdevice is filtereddevice cannot be useddevice is a duplicatedevice not found_lvmcache_update: vgid hash insertion failed: %slvmcache %s: VG %s: set VGID to %.32s.Internal error: vginfo_lookup vgid %s has two names %s %sInternal error: vginfo_lookup %s has_duplicate_local_vgname.vginfo_lookup %s has_duplicate_local_vgname return none.device_list element allocation faileddelete dev from unused duplicates %sdelete dev from initial duplicates %sInternal error: lvmcache_get_bad_mdas no vginfo %sInternal error: lvmcache_get_mdas no vginfo %slvmcache adding vg list alloc failed %slvmcache adding vg name alloc failed %slvmcache adding vginfo for %s %slvmcache adding vginfo found duplicate VG name %sInternal error: lvmcache_update_vgname %s %s %s %sWARNING: VG name %s is used by VGs %s and %s.Fix duplicate VG names with vgrename uuid, a device filter, or system IDs.lvmcache adding vginfo to name hash failed %slvmcache adding vg to name hash failed %sIgnoring lvmcache info for dev %s because dev %s was requested for PVID %s.No lvmcache info for checking bad metadata on %svgnameid_list allocation failed.vgnameid_list member allocation failed.extra md component check skip %llu %llu device_hint %s dev %sextra md component check %llu %llu device_hint %s dev %sIgnoring PV from md component %s with PVID %s (metadata %s %llu)Skip multipath component checks with single device for PVID %sDifferent wwids for duplicate PVs %s %s %s noneDifferent wwids for duplicate PVs %s %s %s %sFound multiple multipath devices for PVID %s WWID %s: %s %sSame wwids for duplicate PVs %s %sFound multipath device %s for PVID %s WWID %s.Using multipath device %s for PVID %s.Ignoring multipath component %s with PVID %s (dropping info)Ignoring multipath component %s with PVID %s (dropping duplicate)Found multiple md devices for PVID %s: %s %sFound md device %s for PVID %s.Using md device %s for PVID %s.Ignoring md component %s with PVID %s (dropping duplicate)PV %s with duplicates unselected using %s.PV %s with duplicates unselected comparing alternativesPV %s with duplicates comparing alternatives for %sPV %s compare duplicates: %s %u:%u. %s %u:%u. device_hint %s.PV %s: device_id %s. %s is %s. %s is %s.PV %s: size %llu. %s is %llu. %s is %llu.PV %s: %s was prev %s. %s was prev %s.PV %s: %s %s subsystem. %s %s subsystem.PV %s: %s %s mounted fs. %s %s mounted fs.PV %s with duplicates will use %s.PV %s with duplicates will change from %s to %s.PV %s with duplicates will continue using %s.Dropping unchosen duplicate %sWARNING: Not using device %s for PV %s.WARNING: PV %s prefers device %s because %s.Internal error: PV %s with duplicates no alternate list entry for %sIgnoring md component %s with PVID %s (dropping info)Checking for multipath components for duplicate PVID %sVG info not dropped before rescan of %sVG info not found after rescan of %sInternal error: NULL vgname handed to cacheFailed to update VG %s info in lvmcache.lvmcache %s mda%d VG %s set seqno %u checksum %x mda_size %zulvmcache %s mda%d VG %s older seqno %u checksum %x mda_size %zulvmcache %s mda%d VG %s newer seqno %u checksum %x mda_size %zuWARNING: scan of VG %s from %s mda%d found mda_checksum %x mda_size %zu vs %x %zulvmcache %s: VG %s %s exported.cache creation host alloc failed for %s.lvmcache %s: VG %s: set creation host to %s.cache lock_type alloc failed for %slvmcache %s: VG %s: set lock_type to %s.cache system_id alloc failed for %slvmcache %s: VG %s: set system_id to %s.Internal error: vginfos list should be emptyInternal error: lvmcache_update_vg %s no vginfoSee vgck --updatemetadata to clear outdated metadata.lvmcache_update_vg %s no info for %s %slvmcache_update_vg %s for info %slvmcache_update_vg %s failed to update info for %slvmcache_update_vg %s copy ignored mdas for %slvmcache_update_vg %s failed to update mdas for %sWARNING: outdated PV %s seqno %u has been removed in current VG %s seqno %u.No cached label for orphan PV %sMust be exactly one data area (found %d) on PV %sMust be at most one bootloader area (found %d) on PV %sPV %s is a different format (seqno %s)lvmcache_info allocation failedSaving initial duplicate device %s previously seen on %s with PVID %s.Initial duplicate already in list %sChanging pvid on dev %s from %s to %sChanging labeller on dev %s from %s to %sInternal error: lvmcache_get_outdated_devs no vginfo %sInternal error: lvmcache_del_outdated_devs no vginfoInternal error: lvmcache_get_outdated_mdas no vginfodevice is rejected by filter configdevice is restricted internallydevice is a multipath componentdevice is too small (pv_min_size)device is not in a usable stateInternal error: Passed segment is not writecache.Internal error: Passed segment has no writecache.WARNING: ignoring writecache setting "cleaner" which is not supported by kernel for LV %s.WARNING: ignoring writecache setting "max_age" which is not supported by kernel for LV %s.origin not specified in segment %s of logical volume %s.origin must be a string in segment %s of logical volume %s.Unknown LV specified for writecache origin %s in segment %s of logical volume %s.writecache not specified in segment %s of logical volume %s.writecache must be a string in segment %s of logical volume %s.Unknown logical volume %s specified for writecache in segment %s of logical volume %s.writecache block_size must be set in segment %s of logical volume %s.Unknown writecache_setting in segment %s of logical volume %s.dm-writecache module version older than minimum 1.0.0String list allocation failed for writecache module.Failed to allocate memory for writecache segtypewritecache/writecache.cwritecache_block_sizehigh_watermarklow_watermarkwriteback_jobsautocommit_blocksautocommit_timemax_agewritecache_setting_keywritecache_setting_valwritecache = "%s"writecache_block_size = %uhigh_watermark = %llulow_watermark = %lluwriteback_jobs = %lluautocommit_blocks = %lluautocommit_time = %llunofua = %ucleaner = %umax_age = %uwritecache_setting_key = "%s"writecache_setting_val = "%s"Initialised segtype: %sintegrity/integrity.cdata_sectorstag_sizeinternal_hashmeta_devjournal_sectorsinterleave_sectorsbuffer_sectorsjournal_watermarkbitmap_flush_intervalsectors_per_bitdata_sectors = %llutag_size = %uinternal_hash = "%s"meta_dev = "%s"recalculate = %ujournal_sectors = %uinterleave_sectors = %ubuffer_sectors = %ujournal_watermark = %ucommit_time = %ubitmap_flush_interval = %usectors_per_bit = %lluUnknown LV specified for integrity origin %s in segment %s of logical volume %s.integrity data_sectors must be set in segment %s of logical volume %s.integrity mode must be set in segment %s of logical volume %s.integrity mode invalid in segment %s of logical volume %s.integrity tag_size must be set in segment %s of logical volume %s.integrity block_size invalid in segment %s of logical volume %s.integrity internal_hash must be set in segment %s of logical volume %s.integrity internal_hash failed to be set in segment %s of logical volume %s.meta_dev must be a string in segment %s of logical volume %s.Unknown logical volume %s specified for integrity in segment %s of logical volume %s.integrity recalculate error in segment %s of logical volume %s.Unknown integrity_setting in segment %s of logical volume %s.String list allocation failed for integrity module.Integrity target version older than minimum 1.6.0Internal error: Passed segment is not integrity._integrity_add_target_line zero sizeFailed to allocate memory for integrity segtype Setting %scache_segtype/cache.ccache_modepolicy_settingschunk_size = %ucache_mode = "%s" Chunk size %s Metadata format %u Mode %s Policy %sCache supports %s.%s: %s failed: %sFound kernel symbol%s.fcloseSMQLVM-cache_pool_corigmetadata_startmetadata_lenmetadata_idcache_pool = "%s"cleaner = 1metadata_format = %umetadata_start = %lumetadata_len = %lumetadata_id = "%s"metadata = "%s"cache-poolmigration_thresholdsequential_thresholdrandom_thresholdread_promote_adjustmentwrite_promote_adjustmentdiscard_promote_adjustment and aliases cache-mqCouldn't read cache chunk_size in segment %s of logical volume %s.cache_mode must be a string in segment %s of logical volume %s.Unknown cache_mode in segment %s of logical volume %s.policy must be a string in segment %s of logical volume %s.Failed to duplicate policy in segment %s of logical volume %s.policy_settings must have a policy_name in segment %s of logical volume %s.policy_settings must be a section in segment %s of logical volume %s.Internal error: Incorrect policy_settings tree, %s.String list allocation failed for cache module.WARNING: The cache kernel module is version %u.%u.%u. Version 1.3.0+ is required.Cache policy %s is available%s.Target %s does not support %s.Target %s %s support disabled by %sInternal error: Passed segment is not cache.cache_add_target_line lv %s pool %sInternal error: LV %s has unknown cache mode %d.LV %s has metadata format %u unsuported by kernel.Using metadata2 format for %s.Internal error: LV %s has unknown metadata format %u.Internal error: LV %s using unsupported ranges with cache pool.Internal error: LV %s has invalid ranges metadata %llu %llu data %llu %llu.WARNING: %s cache policy does not support "%s=%lu" setting, remove with 'lvchange --cachesettings "%s=default" ...'.Cache pool %s is missing cache policy, using %s.Cache pool %s uses implicit metadata format %u.Cache pool %s is missing cache mode, using %s.cache_pool not specified in segment %s of logical volume %s.cache_pool must be a string in segment %s of logical volume %s.Unknown logical volume %s specified for cache_pool in segment %s of logical volume %s.Cache origin not specified in segment %s of logical volume %s.Cache origin must be a string in segment %s of logical volume %s.Unknown logical volume %s specified for cache origin in segment %s of logical volume %s.Could not read cache cleaner in segment %s of logical volume %s.Couldn't read cache metadata_format in segment %s of logical volume %s.Unknown cache metadata format %u number in segment %s of logical volume %s.Couldn't read metadata_start in segment %s of logical volume %s.Couldn't read metadata_len in segment %s of logical volume %s.Couldn't read data_start in segment %s of logical volume %s.Couldn't read data_len in segment %s of logical volume %s.Couldn't allocate metadata_id in segment %s of logical volume %s.Couldn't read metadata_id in segment %s of logical volume %s.Couldn't format metadata_id in segment %s of logical volume %s.Couldn't allocate data_id in segment %s of logical volume %s.Couldn't read data_id in segment %s of logical volume %s.Couldn't format data_id in segment %s of logical volume %s.Internal error: LV %s is using unknown cache metadada format %u.Cache data not specified in segment %s of logical volume %s.Cache data must be a string in segment %s of logical volume %s.Unknown logical volume %s specified for cache data in segment %s of logical volume %s.Cache metadata not specified in segment %s of logical volume %s.Cache metadata must be a string in segment %s of logical volume %s.Unknown logical volume %s specified for cache metadata in segment %s of logical volume %s.Failed to allocate memory for cache_pool segtypeFailed to allocate memory for cache segtype/proc/kallsymsglobal/cache_disabled_featurescacheInternal error: _destroy_config: cmd config tree not destroyed fullyInternal error: Unable to find configuration for log/%s.log/%s contains a value which is not a string. Ignoring.Unrecognised value for log/%s: %s_init_profiles: dm_strncpy failed_init_hostname: dm_pool_strdup failed_init_hostname: dm_pool_strdup kernel_vsn failed_set_tag: str_list_add %s failedInternal error: Unable to find configuration for devices/scan.Invalid string in config file: devices/scanNon standard udev dir %s, resetting devices/obtain_device_list_from_udev.Failed to add %s to internal device cacheWARNING: Metadata changes will NOT be backed upInternal error: Unable to find configuration for log/debug_classes.log/debug_classes contains a value which is not a string. Ignoring.Unrecognised value for log/debug_classes: %sSetting log debug classes to %dInvalid tag in config file: %sInvalid hostname string for tag %sLVM_SYSTEM_DIR or tag was too longconfig_tree_list allocation failedWARNING: Empty system ID supplied.WARNING: Failed to allocate system ID.WARNING: Invalid system ID format: %sWARNING: system ID may not begin with the string "localhost".WARNING: Ignoring extra line(s) in system ID file %s.aAbBcCdDeFGghHIjklmMpPrRsStTuUVwWxXyYzZ%Unrecognised configuration setting for global/units: %sConfigured time format is empty string.Configured time format contains non-printable characters.Invalid time format "%s" supplied.Device directory given in config file too longWARNING: unknown external device info source, using none.WARNING: failed to init udev for external device info, using none.WARNING: proc dir %s not found - some checks will be bypassedNo proc filesystem found: skipping sysfs detectionFailed to create /proc/mounts string for sysfs detectionFailed to find sysfs mount pointInvalid readahead specificationDM_DISABLE_UDEV environment variable set.Overriding configuration to use udev_rules=0, udev_sync=0, verify_udev_operations=1.manage logical volume symlinks in device directoryWARNING: activation/missing_stripe_filler = "%s" is invalid,Falling back to "error" missing_stripe_filler.WARNING: activation/missing_stripe_filler = "%s" is not a block device.Ignoring invalid activation/mlock_filter entry in config fileIgnoring too small pv_min_size %ldKB, using default %dKB.WARNING: local/system_id is set, so should global/system_id_source be "lvmlocal" not "%s"?WARNING: sd_id128_get_machine_app_specific() failed %s (%d).%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02xWARNING: Unrecognised system_id_source "%s".WARNING: No system ID found from system_id_source %s.Internal error: connections must be initialized before filtersFailed to create internal device filterFailed to create global regex device filterFailed to create regex device filterFailed to create lvm type filterFailed to create deviceid device filterFailed to create usabled device filterFailed to create partitioned device filterFailed to create signature device filterFailed to create persistent device filter.Duplicate segment type %s: unloading shared library %sLVM_SYSTEM_DIR environment variable is too long.Internal error: Unprocessed pending delete for %d devices.Failed to allocate command contextFailed to allocate line buffer.Failed to create LVM2 system dir for metadata backups, config files and internal cache.Set environment variable LVM_SYSTEM_DIR to alternative location or empty string.Library memory pool creation failedCommand memory pool creation failedcommands/toolcontext.cfilelinemessageprofile_params alloc failed_init_hostname%s%s%s failed: %sunameSetting host tag: %sFailed to create config tree/dev/archive_init failed.backup_init failed.debug_file_fieldsdebug_output_fieldsLogging initialised at %shost_listhost_filterhost_filter not supported yet%s/lvm%s%s.conflocalhostWARNING: %s: fopen failed: %sdeHImMSuUVwWycCxXyYSet umask from %04o to %04o%s/%s/mounts_get_sysfs_dir fopensysfsDM_DISABLE_UDEVLVM will %s./dev/ioerror stat failed: %sunknown devicelvmlocalappmachineid%s/machine-idLVM_ configuration invalid./run/lvm/lvmpolld.socketLVM_LVMPOLLD_SOCKETLVM_SYSTEM_DIRLVM_RUN_BY_DMEVENTDReloading config filessetlocale failedsetvbufD,!@T"@DEFAULT_SYS_DIR@/@DEFAULT_CACHE_SUBDIR@@DEFAULT_SYS_DIR@/@DEFAULT_BACKUP_SUBDIR@@DEFAULT_SYS_DIR@/@DEFAULT_ARCHIVE_SUBDIR@@DEFAULT_SYS_DIR@/@DEFAULT_PROFILE_SUBDIR@Internal error: _cfg_def_make_path: supplied buffer too small for %s/%sCouldn't create default backup path '%s/%s'.Couldn't create default archive path '%s/%s'.Couldn't create default profile path '%s/%s'.Internal error: Profile %s already added as %s type, but requested type is %s.Failed to create default empty array for %s._get_def_array_values: strdup failedFailed to create default config array value for %s.Failed to duplicate token for default array value of %s.Internal error: Default array value malformed for "%s", value: "%s", token: "%s".Internal error: inconsistent state reached in _check_value_differs_from_defaultFailed to create default config setting node.Failed to create default config setting node value.Internal error: _add_def_node: unknown type_log_array_value_used: failed to write node value%s not found in config: defaulting to %s_config_array_line: dm_pool_strdup failed_get_config_node_version: couldn't create version string%s# This configuration %s is deprecated. %s# This configuration %s is advanced. %s# This configuration %s is not officially supported. %s# This configuration %s has variable name. %s# This configuration %s does not have a default value defined. %s# This configuration %s has an automatic default value. %s# Value defined in existing configuration has been used for this setting. %s# Available since version %s. %s# Deprecated since version %s. Persistent cache directory name too long.WARNING: Configuration setting %s is disabled. Using default value.WARNING: Configuration setting "%s" has invalid type. Found%s but expected%s.Failed to construct path for configuration node %s.Configuration setting "%s" unknown.Configuration section "%s" unknown.Configuration setting "%s" invalid. Empty value not allowed.Configuration setting "%s" invalid. Found string value "%s", expected boolean value: 0/1, "y/n", "yes/no", "on/off", "true/false".Configuration setting "%s" invalid. It cannot be set to an empty value.Configuration %s "%s" is not customizable by a profile.Configuration %s "%s" is customizable by metadata profile only, not command profile.Configuration %s "%s" is customizable by command profile only, not metadata profile.Configuration %s "%s" is not allowed here.Internal error: couldn't determine missing config nodes - unknown status of last config check.Failed to create default config section node.Failed to allocate config source.Failed to allocate config file.Internal error: config_file_check: expected file, special file or profile config source, found %s config source.Internal error: config_file_changed: expected file config source, found %s config source.Config file %s has disappeared!Failed to reload configuration filesConfiguration file %s is not a regular fileDetected config file change to %sFailed to allocate configuration check handle.Internal error: config_file_read_fd: expected file, special file or profile config source, found %s config source.Failed to allocate circular buffer.WARNING: Metadata location on %s at offset %llu begins with invalid name.WARNING: Checksum error on %s at offset %llu.Internal error: %s cfg tree element not declared as boolean.# This is an example configuration file for the LVM2 system. # It contains the default settings that would be used if there was no # @DEFAULT_SYS_DIR@/lvm.conf file. # # Refer to 'man lvm.conf' for further information including the file layout. # # Refer to 'man lvm.conf' for information about how settings configured in # this file are combined with built-in values and command line options to # arrive at the final values used by LVM. # # Refer to 'man lvmconfig' for information about displaying the built-in # and configured values used by LVM. # # If a default value is set in this file (not commented out), then a # new version of LVM using this file will continue using that value, # even if the new version of LVM changes the built-in default value. # # To put this file in a different directory and override @DEFAULT_SYS_DIR@ set # the environment variable LVM_SYSTEM_DIR before running the tools. # # N.B. Take care that each setting only appears once if uncommenting # example settings in this file. # This is a local configuration file template for the LVM2 system # which should be installed as @DEFAULT_SYS_DIR@/lvmlocal.conf . # # Refer to 'man lvm.conf' for information about the file layout. # # To put this file in a different directory and override # @DEFAULT_SYS_DIR@ set the environment variable LVM_SYSTEM_DIR before # running the tools. # # The lvmlocal.conf file is normally expected to contain only the # "local" section which contains settings that should not be shared or # repeated among different hosts. (But if other sections are present, # they *will* get processed. Settings in this file override equivalent # ones in lvm.conf and are in turn overridden by ones in any enabled # lvm_.conf files.) # # Please take care that each setting only appears once if uncommenting # example settings in this file and never copy this file between hosts. Configuration node %s not foundFailed to create default config tree.Failed to create temporary config tree while creating full tree.Failed to clone current config tree.Failed to merge default and current config tree.Internal error: add_profile: incorrect configuration source, expected %s or %s but %s requested%s: bad profile name, it contains '/'.Internal error: add_profile: loaded profile has incorrect type, expected %s but %s foundInternal error: trying to load profile %s in critical section.LVM_SYSTEM_DIR or profile name too longInternal error: _override_config_tree_from_command_profile: config cascade already contains a command profile config.Internal error: _override_config_tree_from_metadata_profile: config cascade already contains a metadata profile config.Internal error: override_config_tree_from_profile: incorrect profile source typeInternal error: %s cfg tree element not declared as string.Internal error: %s cfg tree element not declared to allow empty values.Persistent cache filename too long.Internal error: %s cfg tree element not declared as integer.Internal error: %s cfg tree element not declared as float.Failed to create configuration definition hash.Failed to insert configuration to hash.Configuration setting "%s" invalid. It's not part of any section._check_profile: profile check handle allocation failedInternal error: override_config_tree_from_string: config cascade already contains a string config.Failed to set overridden configuration entries.Ignoring invalid configuration string.Internal error: %s cfg tree element not declared as array.Failed to create default array node for %s.WARNING: Configured cache_pool_max_chunks value %lu is higher then recommended %lu.How LVM configuration settings are handled. How LVM selects space and applies properties to LVs. How LVM log information is reported. How LVM metadata is backed up and archived. In LVM, a 'backup' is a copy of the metadata for the current system, and an 'archive' contains old metadata configurations. They are stored in a human readable text format. Settings for running LVM in shell (readline) mode. Miscellaneous global LVM settings. LVM report command output formatting. Settings for the LVM event daemon. LVM settings that are specific to the local host. If enabled, any LVM configuration mismatch is reported. This implies checking that the configuration key is understood by LVM and that the value of the key is the proper type. If disabled, any configuration mismatch is ignored and the default value is used without any warning (a message about the configuration key not being found is issued in verbose mode only). Abort the LVM process if a configuration mismatch is found. Directory where LVM looks for configuration profiles. Directory in which to create volume group device nodes. Commands also accept this as a prefix on volume group names. Directories containing device nodes to use with LVM. Obtain the list of available devices from udev. This avoids opening or using any inapplicable non-block devices or subdirectories found in the udev directory. Any device node or symlink not managed by udev in the udev directory is ignored. This setting applies only to the udev-managed device directory; other directories will be scanned fully. LVM needs to be compiled with udev support for this setting to apply. Enable device information from udev. If set to "udev", lvm will supplement its own native device information with information from libudev. This can potentially improve the detection of MD component devices and multipath component devices. Use a local file to remember which devices have PVs on them. Some commands will use this as an optimization to reduce device scanning, and will only scan the listed PVs. Removing the hint file will cause lvm to generate a new one. Disable hints if PVs will be copied onto devices using non-lvm commands, like dd. # Accepted values: all Use all hints. none Use no hints. # Select which path name to display for a block device. If multiple path names exist for a block device, and LVM needs to display a name for the device, the path names are matched against each item in this list of regular expressions. The first match is used. Try to avoid using undescriptive /dev/dm-N names, if present. If no preferred name matches, or if preferred_names are not defined, the following built-in preferences are applied in order until one produces a preferred name: Prefer names with path prefixes in the order of: /dev/mapper, /dev/disk, /dev/dm-*, /dev/block. Prefer the name with the least number of slashes. Prefer a name that is a symlink. Prefer the path with least value in lexicographical order. # Example preferred_names = [ "^/dev/mpath/", "^/dev/mapper/mpath", "^/dev/[hs]d" ] # Enable or disable the use of a devices file. When enabled, lvm will only use devices that are lised in the devices file. A devices file will be used, regardless of this setting, when the --devicesfile option is set to a specific file name. The name of the system devices file, listing devices that LVM should use. This should not be used to select a non-system devices file. The --devicesfile option is intended for alternative devices files. Look outside of the devices file for missing devname entries. A devname entry is used for a device that does not have a stable device id, e.g. wwid, so the unstable device name is used as the device id. After reboot, or if the device is reattached, the device name may change, in which case lvm will not find the expected PV on the device listed in the devices file. This setting controls whether lvm will search other devices, outside the devices file, to look for the missing PV on a renamed device. If "none", lvm will not look at other devices, and the PV may appear to be missing. If "auto", lvm will look at other devices, but only those that are likely to have the PV. If "all", lvm will look at all devices on the system. Limit the block devices that are used by LVM commands. This is a list of regular expressions used to accept or reject block device path names. Each regex is delimited by a vertical bar '|' (or any character) and is preceded by 'a' to accept the path, or by 'r' to reject the path. The first regex in the list to match the path is used, producing the 'a' or 'r' result for the device. When multiple path names exist for a block device, if any path name matches an 'a' pattern before an 'r' pattern, then the device is accepted. If all the path names match an 'r' pattern first, then the device is rejected. Unmatching path names do not affect the accept or reject decision. If no path names for a device match a pattern, then the device is accepted. Be careful mixing 'a' and 'r' patterns, as the combination might produce unexpected results (test changes.) Run vgscan after changing the filter to regenerate the cache. # Example Accept every block device: filter = [ "a|.*|" ] Reject the cdrom drive: filter = [ "r|/dev/cdrom|" ] Work with just loopback devices, e.g. for testing: filter = [ "a|loop|", "r|.*|" ] Accept all loop devices and ide drives except hdc: filter = [ "a|loop|", "r|/dev/hdc|", "a|/dev/ide|", "r|.*|" ] Use anchors to be very specific: filter = [ "a|^/dev/hda8$|", "r|.*|" ] # Limit the block devices that are used by LVM system components. Because devices/filter may be overridden from the command line, it is not suitable for system-wide device filtering, e.g. udev. Use global_filter to hide devices from these LVM system components. The syntax is the same as devices/filter. Devices rejected by global_filter are not opened by LVM. List of additional acceptable block device types. These are of device type names from /proc/devices, followed by the maximum number of partitions. # Example types = [ "fd", 16 ] # Restrict device scanning to block devices appearing in sysfs. This is a quick way of filtering out block devices that are not present on the system. sysfs must be part of the kernel and mounted.) Scan LVM LVs for layered PVs, allowing LVs to be used as PVs. When 1, LVM will detect PVs layered on LVs, and caution must be taken to avoid a host accessing a layered VG that may not belong to it, e.g. from a guest image. This generally requires excluding the LVs with device filters. Also, when this setting is enabled, every LVM command will scan every active LV on the system (unless filtered), which can cause performance problems on systems with many active LVs. When this setting is 0, LVM will not detect or use PVs that exist on LVs, and will not allow a PV to be created on an LV. The LVs are ignored using a built in device filter that identifies and excludes LVs. Ignore devices that are components of DM multipath devices. The path to the multipath wwids file used for multipath component detection. Set this to an empty string to disable the use of the multipath wwids file. Enable detection and exclusion of MD component devices. An MD component device is a block device that MD uses as part of a software RAID virtual device. When an LVM PV is created on an MD device, LVM must only use the top level MD device as the PV, and should ignore the underlying component devices. In cases where the MD superblock is located at the end of the component devices, it is more difficult for LVM to consistently identify an MD component, see the md_component_checks setting. The checks LVM should use to detect MD component devices. MD component devices are block devices used by MD software RAID. # Accepted values: auto LVM will skip scanning the end of devices when it has other indications that the device is not an MD component. start LVM will only scan the start of devices for MD superblocks. This does not incur extra I/O by LVM. full LVM will scan the start and end of devices for MD superblocks. This requires an extra read at the end of devices. # Ignore devices that are components of firmware RAID devices. LVM must use an external_device_info_source other than none for this detection to execute. Align the start of a PV data area with md device's stripe-width. This applies if a PV is placed directly on an md device. default_data_alignment will be overridden if it is not aligned with the value detected for this setting. This setting is overridden by data_alignment_detection, data_alignment, and the --dataalignment option. Align the start of a PV data area with this number of MiB. Set to 1 for 1MiB, 2 for 2MiB, etc. Set to 0 to disable. This setting is overridden by data_alignment and the --dataalignment option. Align the start of a PV data area with sysfs io properties. The start of a PV data area will be a multiple of minimum_io_size or optimal_io_size exposed in sysfs. minimum_io_size is the smallest request the device can perform without incurring a read-modify-write penalty, e.g. MD chunk size. optimal_io_size is the device's preferred unit of receiving I/O, e.g. MD stripe width. minimum_io_size is used if optimal_io_size is undefined (0). If md_chunk_alignment is enabled, that detects the optimal_io_size. default_data_alignment and md_chunk_alignment will be overridden if they are not aligned with the value detected for this setting. This setting is overridden by data_alignment and the --dataalignment option. Align the start of a PV data area with this number of KiB. When non-zero, this setting overrides default_data_alignment. Set to 0 to disable, in which case default_data_alignment is used to align the first PE in units of MiB. This setting is overridden by the --dataalignment option. data_alignment_offset_detectionShift the start of an aligned PV data area based on sysfs information. After a PV data area is aligned, it will be shifted by the alignment_offset exposed in sysfs. This offset is often 0, but may be non-zero. Certain 4KiB sector drives that compensate for windows partitioning will have an alignment_offset of 3584 bytes (sector 7 is the lowest aligned logical block, the 4KiB sectors start at LBA -1, and consequently sector 63 is aligned on a 4KiB boundary). This setting is overridden by the --dataalignmentoffset option. Ignore DM devices that have I/O suspended while scanning devices. Otherwise, LVM waits for a suspended device to become accessible. This should only be needed in recovery situations. Do not scan 'mirror' LVs to avoid possible deadlocks. This avoids possible deadlocks when using the 'mirror' segment type. This setting determines whether LVs using the 'mirror' segment type are scanned for LVM labels. This affects the ability of mirrors to be used as physical volumes. If this setting is enabled, it is impossible to create VGs on top of mirror LVs, i.e. to stack VGs on mirror LVs. If this setting is disabled, allowing mirror LVs to be scanned, it may cause LVM processes and I/O to the mirror to become blocked. This is due to the way that the mirror segment type handles failures. In order for the hang to occur, an LVM command must be run just after a failure and before the automatic LVM repair process takes place, or there must be failures in multiple mirrors in the same VG at the same time with write failures occurring moments before a scan of the mirror's labels. The 'mirror' scanning problems do not apply to LVM RAID types like 'raid1' which handle failures in a different way, making them a better choice for VG stacking. Allow use of pvcreate --uuid without requiring --restorefile. Minimum size in KiB of block devices which can be used as PVs. In a clustered environment all nodes must use the same value. Any value smaller than 512KiB is ignored. The previous built-in value was 512. Issue discards to PVs that are no longer used by an LV. Discards are sent to an LV's underlying physical volumes when the LV is no longer using the physical volumes' space, e.g. lvremove, lvreduce. Discards inform the storage that a region is no longer used. Storage that supports discards advertise the protocol-specific way discards should be issued by the kernel (TRIM, UNMAP, or WRITE SAME with UNMAP bit set). Not all storage will support or benefit from discards, but SSDs and thinly provisioned LUNs generally do. If enabled, discards will only be issued if both the storage and kernel provide support. allow_changes_with_duplicate_pvsAllow VG modification while a PV appears on multiple devices. When a PV appears on multiple devices, LVM attempts to choose the best device to use for the PV. If the devices represent the same underlying storage, the choice has minimal consequence. If the devices represent different underlying storage, the wrong choice can result in data loss if the VG is modified. Disabling this setting is the safest option because it prevents modifying a VG or activating LVs in it while a PV appears on multiple devices. Enabling this setting allows the VG to be used as usual even with uncertain devices. Allow PVs in the same VG with different logical block sizes. When allowed, the user is responsible to ensure that an LV is using PVs with matching block sizes when necessary. Advise LVM which PVs to use when searching for new space. When searching for free space to extend an LV, the 'cling' allocation policy will choose space on the same PVs as the last segment of the existing LV. If there is insufficient space and a list of tags is defined here, it will check whether any of them are attached to the PVs concerned and then seek to match those PV tags between existing extents and new extents. # Example Use the special tag "@*" as a wildcard to match any PV tag: cling_tag_list = [ "@*" ] LVs are mirrored between two sites within a single VG, and PVs are tagged with either @site1 or @site2 to indicate where they are situated: cling_tag_list = [ "@site1", "@site2" ] # Use a previous allocation algorithm. Changes made in version 2.02.85 extended the reach of the 'cling' policies to detect more situations where data can be grouped onto the same disks. This setting can be used to disable the changes and revert to the previous algorithm. Use blkid to detect and erase existing signatures on new PVs and LVs. The blkid library can detect more signatures than the native LVM detection code, but may take longer. LVM needs to be compiled with blkid wiping support for this setting to apply. LVM native detection code is currently able to recognize: MD device signatures, swap signature, and LUKS signatures. To see the list of signatures recognized by blkid, check the output of the 'blkid -k' command. wipe_signatures_when_zeroing_new_lvsLook for and erase any signatures while zeroing a new LV. The --wipesignatures option overrides this setting. Zeroing is controlled by the -Z/--zero option, and if not specified, zeroing is used by default if possible. Zeroing simply overwrites the first 4KiB of a new LV with zeroes and does no signature detection or wiping. Signature wiping goes beyond zeroing and detects exact types and positions of signatures within the whole LV. It provides a cleaner LV after creation as all known signatures are wiped. The LV is not claimed incorrectly by other tools because of old signatures from previous use. The number of signatures that LVM can detect depends on the detection code that is selected (see use_blkid_wiping.) Wiping each detected signature must be confirmed. When this setting is disabled, signatures on new LVs are not detected or erased unless the --wipesignatures option is used directly. mirror_logs_require_separate_pvsMirror logs and images will always use different PVs. The default setting changed in version 2.02.85. Stripe across all PVs when RAID stripes are not specified. If enabled, all PVs in the VG or on the command line are used for raid0/4/5/6/10 when the command does not specify the number of stripes to use. This was the default behaviour until release 2.02.162. cache_pool_metadata_require_separate_pvsCache pool metadata and data will always use different PVs. This has been replaced by the allocation/cache_mode setting. Sets default metadata format for new cache. # Accepted values: 0 Automatically detected best available format 1 Original format 2 Improved 2nd. generation format # The default cache mode used for new cache. # Accepted values: writethrough Data blocks are immediately written from the cache to disk. writeback Data blocks are written from the cache back to disk after some delay to improve performance. # This setting replaces allocation/cache_pool_cachemode. The default cache policy used for new cache volume. Since kernel 4.2 the default policy is smq (Stochastic multiqueue), otherwise the older mq (Multiqueue) policy is selected. Settings for the cache policy. See documentation for individual cache policies for more info. Replace this subsection name with a policy name. Multiple subsections for different policies can be created. The minimal chunk size in KiB for cache pool volumes. Using a chunk_size that is too large can result in wasteful use of the cache, where small reads and writes can cause large sections of an LV to be mapped into the cache. However, choosing a chunk_size that is too small can result in more overhead trying to manage the numerous chunks that become mapped into the cache. The former is more of a problem than the latter in most cases, so the default is on the smaller end of the spectrum. Supported values range from 32KiB to 1GiB in multiples of 32. The maximum number of chunks in a cache pool. For cache target v1.9 the recommended maximumm is 1000000 chunks. Using cache pool with more chunks may degrade cache performance. thin_pool_metadata_require_separate_pvsThin pool metadata and data will always use different PVs. Older version of lvm2 cropped pool's metadata size to 15.81 GiB. This is slightly less then the actual maximum 15.88 GiB. For compatibility with older version and use of cropped size set to 1. Thin pool data chunks are zeroed before they are first used. Zeroing with a larger thin pool chunk size reduces performance. The discards behaviour of thin pool volumes. # Accepted values: ignore nopassdown passdown # The chunk size calculation policy for thin pool volumes. # Accepted values: generic If thin_pool_chunk_size is defined, use it. Otherwise, calculate the chunk size based on estimation and device hints exposed in sysfs - the minimum_io_size. The chunk size is always at least 64KiB. performance If thin_pool_chunk_size is defined, use it. Otherwise, calculate the chunk size for performance based on device hints exposed in sysfs - the optimal_io_size. The chunk size is always at least 512KiB. # Zero whole metadata area before use with thin or cache pool. The minimal chunk size in KiB for thin pool volumes. Larger chunk sizes may improve performance for plain thin volumes, however using them for snapshot volumes is less efficient, as it consumes more space and takes extra time for copying. When unset, lvm tries to estimate chunk size starting from 64KiB. Supported values are in the range 64KiB to 1GiB. Default physical extent size in KiB to use for new VGs. Enables or disables compression when creating a VDO volume. Compression may be disabled if necessary to maximize performance or to speed processing of data that is unlikely to compress. Enables or disables deduplication when creating a VDO volume. Deduplication may be disabled in instances where data is not expected to have good deduplication rates but compression is still desired. Enables or disables whether VDO volume should tag its latency-critical writes with the REQ_SYNC flag. Some device mapper targets such as dm-raid5 process writes with this flag at a higher priority. The minimum IO size for VDO volume to accept, in bytes. Valid values are 512 or 4096. The recommended value is 4096. Specifies the amount of memory in MiB allocated for caching block map pages for VDO volume. The value must be a multiple of 4096 and must be at least 128MiB and less than 16TiB. The cache must be at least 16MiB per logical thread. Note that there is a memory overhead of 15%. The speed with which the block map cache writes out modified block map pages. A smaller era length is likely to reduce the amount time spent rebuilding, at the cost of increased block map writes during normal operation. The maximum and recommended value is 16380; the minimum value is 1. Deprecated option to set default check point frequency for VDO volume. Enables sparse indexing for VDO volume. Specifies the amount of index memory in MiB for VDO volume. The value must be at least 256MiB and at most 1TiB. Specifies the size in MiB of the increment by which a VDO is grown. Using a smaller size constrains the total maximum physical size that can be accommodated. Must be a power of two between 128MiB and 32GiB. Specifies the number of threads to use for acknowledging completion of requested VDO I/O operations. The value must be at in range [0..100]. Specifies the number of threads to use for submitting I/O operations to the storage device of VDO volume. The value must be in range [1..100]. Each additional thread after the first will use an additional 18MiB of RAM, plus 1.12 MiB of RAM per megabyte of configured read cache size. Specifies the number of I/O operations to enqueue for each bio-submission thread before directing work to the next. The value must be in range [1..1024]. Specifies the number of threads to use for CPU-intensive work such as hashing or compression for VDO volume. The value must be in range [1..100]. Specifies the number of threads across which to subdivide parts of the VDO processing based on the hash value computed from the block data. The value must be at in range [0..100]. vdo_hash_zone_threads, vdo_logical_threads and vdo_physical_threads must be either all zero or all non-zero. Specifies the number of threads across which to subdivide parts of the VDO processing based on the hash value computed from the block data. A logical thread count of 9 or more will require explicitly specifying a sufficiently large block map cache size, as well. The value must be in range [0..60]. vdo_hash_zone_threads, vdo_logical_threads and vdo_physical_threads must be either all zero or all non-zero. Specifies the number of threads across which to subdivide parts of the VDO processing based on physical block addresses. Each additional thread after the first will use an additional 10MiB of RAM. The value must be in range [0..16]. vdo_hash_zone_threads, vdo_logical_threads and vdo_physical_threads must be either all zero or all non-zero. Specifies the write policy: auto - VDO will check the storage device and determine whether it supports flushes. If it does, VDO will run in async mode, otherwise it will run in sync mode. sync - Writes are acknowledged only after data is stably written. This policy is not supported if the underlying storage is not also synchronous. async - Writes are acknowledged after data has been cached for writing to stable storage. Data which has not been flushed is not guaranteed to persist in this mode. async-unsafe - Writes are handled like 'async' but there is no guarantee of the atomicity async provides. This mode should only be used for better performance when atomicity is not required. Specified the maximum size of discard bio accepted, in 4096 byte blocks. I/O requests to a VDO volume are normally split into 4096-byte blocks, and processed up to 2048 at a time. However, discard requests to a VDO volume can be automatically split to a larger size, up to 4096-byte blocks in a single bio, and are limited to 1500 at a time. Increasing this value may provide better overall performance, at the cost of increased latency for the individual discard requests. The default and minimum is 1. The maximum is UINT_MAX / 4096. Specified the emptry header size in KiB at the front and end of vdo pool device. Enable or disable LVM log reporting. If enabled, LVM will collect a log of operations, messages, per-object return codes with object identification and associated error numbers (errnos) during LVM command processing. Then the log is either reported solely or in addition to any existing reports, depending on LVM command used. If it is a reporting command (e.g. pvs, vgs, lvs, lvm fullreport), then the log is reported in addition to any existing reports. Otherwise, there's only log report on output. For all applicable LVM commands, you can request that the output has only log report by using --logonly command line option. Use log/command_log_cols and log/command_log_sort settings to define fields to display and sort fields for the log report. You can also use log/command_log_selection to define selection criteria used each time the log is reported. List of columns to sort by when reporting command log. See --logonly --configreport log -o help for the list of possible fields. log_seq_num,log_type,log_context,log_object_type,log_object_name,log_object_id,log_object_group,log_object_group_id,log_message,log_errno,log_ret_codeList of columns to report when reporting command log. See --logonly --configreport log -o help for the list of possible fields. !(log_type=status && message=success)Selection criteria used when reporting command log. You can define selection criteria that are applied each time log is reported. This way, it is possible to control the amount of log that is displayed on output and you can select only parts of the log that are important for you. To define selection criteria, use fields from log report. See also --logonly --configreport log -S help for the list of possible fields and selection operators. You can also define selection criteria for log report on command line directly using --configreport log -S which has precedence over log/command_log_selection setting. For more information about selection criteria in general, see lvm(8) man page. Controls the messages sent to stdout or stderr. Suppress all non-essential messages from stdout. This has the same effect as -qq. When enabled, the following commands still produce output: dumpconfig, lvdisplay, lvmdiskscan, lvs, pvck, pvdisplay, pvs, version, vgcfgrestore -l, vgdisplay, vgs. Non-essential messages are shifted from log level 4 to log level 5 for syslog and lvm2_log_fn purposes. Any 'yes' or 'no' questions not overridden by other arguments are suppressed and default to 'no'. Send log messages through syslog. Write error and debug log messages to a file specified here. Record lvm information in the systemd journal. command: record commands that are run. output: record default output from commands. debug: record debug messages from commands. Overwrite the log file each time the program is run. The level of log messages that are sent to the log file or syslog. There are 6 syslog-like log levels currently in use: 2 to 7 inclusive. 7 is the most verbose (LOG_DEBUG). Indent messages according to their severity. Display the command name on each line of output. A prefix to use before the log message text. (After the command name, if selected). Two spaces allows you to see/grep the severity of each message. To make the messages look similar to the original LVM tools use: indent = 0, command_names = 1, prefix = " -- " Log messages during activation. Don't use this in low memory situations (can deadlock). #Smemory#Sdevices#Sio#Sactivation#Sallocation#Smetadata#Scache#Slocking#Slvmpolld#SdbusSelect log messages by class. Some debugging messages are assigned to a class and only appear in debug output if the class is listed here. Classes currently available: memory, devices, io, activation, allocation, metadata, cache, locking, lvmpolld. Use "all" to see everything. #Stime#Scommand#Sfileline#SmessageThe fields included in debug output written to log file. Use "all" to include everything (the default). The fields included in debug output written to stderr. Use "all" to include everything (the default). Maintain a backup of the current metadata configuration. Think very hard before turning this off! Location of the metadata backup files. Remember to back up this directory regularly! Maintain an archive of old metadata configurations. Think very hard before turning this off. Location of the metdata archive files. Remember to back up this directory regularly! Minimum number of archives to keep. Minimum number of days to keep archive files. Number of lines of history to store in ~/.lvm_history. The file creation mask for any files and directories created. Interpreted as octal if the first digit is zero. No on-disk metadata changes will be made in test mode. Equivalent to having the -t option on every command. Default value for --units argument. Distinguish between powers of 1024 and 1000 bytes. The LVM commands distinguish between powers of 1024 bytes, e.g. KiB, MiB, GiB, and powers of 1000 bytes, e.g. KB, MB, GB. If scripts depend on the old behaviour, disable this setting temporarily until they are updated. Display unit suffix for sizes. This setting has no effect if the units are in human-readable form (global/units = "h") in which case the suffix is always displayed. Enable/disable communication with the kernel device-mapper. Disable to use the tools to manipulate LVM metadata without activating any logical volumes. If the device-mapper driver is not present in the kernel, disabling this should suppress the error messages. Location of /etc system configuration directory. When disabled, fail if a lock request would block. Directory to use for LVM command file locks. Local non-LV directory that holds file-based locks while commands are in progress. A directory like /tmp that may get wiped on reboot is OK. Allow quicker VG write access during high volume read access. When there are competing read-only and read-write access requests for a volume group's metadata, instead of always granting the read-only requests immediately, delay them to allow the read-write requests to be serviced. Without this setting, write access may be stalled by a high volume of read-only requests. This option only affects file locks. Search this directory first for shared libraries. Abort a command that encounters an internal error. Treat any internal errors as fatal errors, aborting the process that encountered the internal error. Please only enable for debugging. detect_internal_vg_cache_corruptionNo operations that change on-disk metadata are permitted. Additionally, read-only commands that encounter metadata in need of repair will still be allowed to proceed exactly as if the repair had been performed (except for the unchanged vg_seqno). Inappropriate use could mess up your system, so seek advice first! The segment type used by the short mirroring option -m. The --type mirror|raid1 option overrides this setting. # Accepted values: mirror The original RAID1 implementation from LVM/DM. It is characterized by a flexible log solution (core, disk, mirrored), and by the necessity to block I/O while handling a failure. There is an inherent race in the dmeventd failure handling logic with snapshots of devices using this type of RAID1 that in the worst case could cause a deadlock. (Also see devices/ignore_lvm_mirrors.) raid1 This is a newer RAID1 implementation using the MD RAID1 personality through device-mapper. It is characterized by a lack of log options. (A log is always allocated for every device and they are placed on the same device as the image, so no separate devices are required.) This mirror implementation does not require I/O to be blocked while handling a failure. This mirror implementation is not cluster-aware and cannot be used in a shared (active/active) fashion in a cluster. # Enable mirrored 'mirror' log type for testing. # This type is deprecated to create or convert to but can be enabled to test that activation of existing mirrored logs and conversion to disk/core works. # Not supported for regular operation! The segment type used by the -i -m combination. The --type raid10|mirror option overrides this setting. The --stripes/-i and --mirrors/-m options can both be specified during the creation of a logical volume to use both striping and mirroring for the LV. There are two different implementations. # Accepted values: raid10 LVM uses MD's RAID10 personality through DM. This is the preferred option. mirror LVM layers the 'mirror' and 'stripe' segment types. The layering is done by creating a mirror LV on top of striped sub-LVs, effectively creating a RAID 0+1 array. The layering is suboptimal in terms of providing redundancy and performance. # The segment type used by the -V -L combination. The --type snapshot|thin option overrides this setting. The combination of -V and -L options creates a sparse LV. There are two different implementations. # Accepted values: snapshot The original snapshot implementation from LVM/DM. It uses an old snapshot that mixes data and metadata within a single COW storage volume and performs poorly when the size of stored data passes hundreds of MB. thin A newer implementation that uses thin provisioning. It has a bigger minimal chunk size (64KiB) and uses a separate volume for metadata. It has better performance, especially when more data is used. It also supports full snapshots. # lvdisplay_shows_full_device_pathEnable this to reinstate the previous lvdisplay name format. The default format for displaying LV names in lvdisplay was changed in version 2.02.89 to show the LV name and path separately. Previously this was always shown as /dev/vgname/lvname even when that was never a valid path in the /dev filesystem. Activate LVs based on system-generated device events. When a PV appears on the system, a system-generated uevent triggers the lvm2-pvscan service which runs the pvscan --cache -aay command. If the new PV completes a VG, pvscan autoactivates LVs in the VG. When event_activation is disabled, the lvm2-activation services are generated and run at fixed points during system startup. These services run vgchange -aay to autoactivate LVs in VGs that happen to be present at that point in time. See the --setautoactivation option or the auto_activation_volume_list setting to configure autoactivation for specific VGs or LVs. Use async I/O when reading and writing devices. Use lvmlockd for locking among hosts using LVM on shared storage. Applicable only if LVM is compiled with lockd support in which case there is also lvmlockd(8) man page available for more information. Retry lvmlockd lock requests this many times. Applicable only if LVM is compiled with lockd support Size in MiB to extend the internal LV holding sanlock locks. The internal LV holds locks for each LV in the VG, and after enough LVs have been created, the internal LV needs to be extended. lvcreate will automatically extend the internal LV when needed by the amount specified here. Setting this to 0 disables the automatic extension and can cause lvcreate to fail. Applicable only if LVM is compiled with lockd support The command that lvmlockctl --kill should use to force LVs offline. The lvmlockctl --kill command is run when a shared VG has lost access to locks (e.g. when sanlock has lost access to storage.) An empty string means that there will be no automatic attempt by lvmlockctl --kill to forcibly shut down LVs in the VG, and the user can manually intervene as described in lvmlockd(8). The VG name will be appended to the command specified here. The full path to the thin_check command. LVM uses this command to check that a thin metadata device is in a usable state. When a thin pool is activated and after it is deactivated, this command is run. Activation will only proceed if the command has an exit status of 0. Set to "" to skip this check. (Not recommended.) Also see thin_check_options. (See package device-mapper-persistent-data or thin-provisioning-tools) The full path to the thin_dump command. LVM uses this command to dump thin pool metadata. (See package device-mapper-persistent-data or thin-provisioning-tools) The full path to the thin_repair command. LVM uses this command to repair a thin metadata device if it is in an unusable state. Also see thin_repair_options. (See package device-mapper-persistent-data or thin-provisioning-tools) #S-q#S--clear-needs-check-flagList of options passed to the thin_check command. With thin_check version 2.1 or newer you can add the option --ignore-non-fatal-errors to let it pass through ignorable errors and fix them later. With thin_check version 3.2 or newer you should include the option --clear-needs-check-flag. List of options passed to the thin_repair command. Features to not use in the thin driver. This can be helpful for testing, or to avoid using a feature that is causing problems. Features include: block_size, discards, discards_non_power_2, external_origin, metadata_resize, external_origin_extend, error_if_no_space. # Example thin_disabled_features = [ "discards", "block_size" ] # Features to not use in the cache driver. This can be helpful for testing, or to avoid using a feature that is causing problems. Features include: policy_mq, policy_smq, metadata2. # Example cache_disabled_features = [ "policy_smq" ] # The full path to the cache_check command. LVM uses this command to check that a cache metadata device is in a usable state. When a cached LV is activated and after it is deactivated, this command is run. Activation will only proceed if the command has an exit status of 0. Set to "" to skip this check. (Not recommended.) Also see cache_check_options. (See package device-mapper-persistent-data or thin-provisioning-tools) The full path to the cache_dump command. LVM uses this command to dump cache pool metadata. (See package device-mapper-persistent-data or thin-provisioning-tools) The full path to the cache_repair command. LVM uses this command to repair a cache metadata device if it is in an unusable state. Also see cache_repair_options. (See package device-mapper-persistent-data or thin-provisioning-tools) List of options passed to the cache_check command. With cache_check version 5.0 or newer you should include the option --clear-needs-check-flag. List of options passed to the cache_repair command. The full path to the vdoformat command. LVM uses this command to initial data volume for VDO type logical volume List of options passed added to standard vdoformat command. Features to not use in the vdo driver. This can be helpful for testing, or to avoid using a feature that is causing problems. Features include: online_rename, version4 # Example vdo_disabled_features = [ "online_rename", "version4" ] # The full path to the fsadm command. LVM uses this command to help with lvresize -r operations. The method LVM uses to set the local system ID. Volume Groups can also be given a system ID (by vgcreate, vgchange, or vgimport.) A VG on shared storage devices is accessible only to the host with a matching system ID. See 'man lvmsystemid' for information on limitations and correct usage. # Accepted values: none The host has no system ID. lvmlocal Obtain the system ID from the system_id setting in the 'local' section of an lvm configuration file, e.g. lvmlocal.conf. uname Set the system ID from the hostname (uname) of the system. System IDs beginning localhost are not permitted. appmachineid Use an LVM-specific derivation of the local machine-id as the system ID. See 'man machine-id'. machineid Use the contents of the machine-id file to set the system ID (appmachineid is recommended.) file Use the contents of another file (system_id_file) to set the system ID. # The full path to the file containing a system ID. This is used when system_id_source is set to 'file'. Comments starting with the character # are ignored. Perform internal checks of libdevmapper operations. Useful for debugging problems with activation. Some of the checks may be expensive, so it's best to use this only when there seems to be a problem. Use lvmpolld to supervise long running LVM commands. When enabled, control of long running LVM commands is transferred from the original LVM command to the lvmpolld daemon. This allows the operation to continue independent of the original LVM command. After lvmpolld takes over, the LVM command displays the progress of the ongoing operation. lvmpolld itself runs LVM commands to manage the progress of ongoing operations. lvmpolld can be used as a native systemd service, which allows it to be started on demand, and to use its own control group. When this option is disabled, LVM commands will supervise long running operations by forking themselves. Applicable only if LVM is compiled with lvmpolld support. Enable D-Bus notification from LVM commands. When enabled, an LVM command that changes PVs, changes VG metadata, or changes the activation state of an LV will send a notification. The amount of memory in KiB that LVM allocates to perform disk io. LVM performance may benefit from more io memory when there are many disks or VG metadata is large. Increasing this size may be necessary when a single copy of VG metadata is larger than the current setting. This value should usually not be decreased from the default; setting it too low can result in lvm failing to read VGs. Use udev notifications to synchronize udev and LVM. The --noudevsync option overrides this setting. When disabled, LVM commands will not wait for notifications from udev, but continue irrespective of any possible udev processing in the background. Only use this if udev is not running or has rules that ignore the devices LVM creates. If enabled when udev is not running, and LVM processes are waiting for udev, run the command 'dmsetup udevcomplete_all' to wake them up. Use udev rules to manage LV device nodes and symlinks. When disabled, LVM will manage the device nodes and symlinks for active LVs itself. Manual intervention may be required if this setting is changed while LVs are active. Use extra checks in LVM to verify udev operations. This enables additional checks (and if necessary, repairs) on entries in the device directory after udev has completed processing its events. Useful for diagnosing problems with LVM/udev interactions. Retry failed LV deactivation. If LV deactivation fails, LVM will retry for a few seconds before failing. This may happen because a process run from a quick udev rule temporarily opened the device. Method to fill missing stripes when activating an incomplete LV. Using 'error' will make inaccessible parts of the device return I/O errors on access. Using 'zero' will return success (and zero) on I/O You can instead use a device path, in which case, that device will be used in place of missing stripes. Using anything other than 'error' with mirrored or snapshotted volumes is likely to result in data corruption. Use the linear target to optimize single stripe LVs. When disabled, the striped target is used. The linear target is an optimised version of the striped target that only handles a single stripe. Stack size in KiB to reserve for use while devices are suspended. Insufficent reserve risks I/O deadlock during device suspension. Memory size in KiB to reserve for use while devices are suspended. Insufficent reserve risks I/O deadlock during device suspension. Nice value used while devices are suspended. Use a high priority so that LVs are suspended for the shortest possible time. Only LVs selected by this list are activated. If this list is defined, an LV is only activated if it matches an entry in this list. If this list is undefined, it imposes no limits on LV activation (all are allowed). # Accepted values: vgname The VG name is matched exactly and selects all LVs in the VG. vgname/lvname The VG name and LV name are matched exactly and selects the LV. @tag Selects an LV if the specified tag matches a tag set on the LV or VG. @* Selects an LV if a tag defined on the host is also set on the LV or VG. See tags/hosttags. If any host tags exist but volume_list is not defined, a default single-entry list containing '@*' is assumed. # Example volume_list = [ "vg1", "vg2/lvol1", "@tag1", "@*" ] # A list of VGs or LVs that should be autoactivated. Autoactivation is an activation command run with -aay, i.e. vgchange -aay, lvchange -aay, or pvscan --cache -aay. When this list is defined, an autoactivation command will only activate LVs included in the list. If this list is undefined, it has no effect. If this list is defined but empty, then no LVs will be autoactivated. LVs can be included in the list by LV name, VG name (applies to all LVs in the VG), or tag name. VGs and LVs can also have an autoactivation property set in metadata, see --setautoactivation. LVs included in this list will not be autoactivated if the VG or LV autoactivation property is disabled (see vgs or lvs "-o autoactivation"). The volume_list setting and the "activation skip" property also apply to autoactivation. The -aay option is meant to be used by activation commands that are run automatically by the system, e.g. from systemd services. # Accepted values: vgname The VG name is matched exactly and selects all LVs in the VG. vgname/lvname The VG name and LV name are matched exactly and selects the LV. @tag Selects an LV if the specified tag matches a tag set on the LV or VG. @* Selects an LV if a tag defined on the host is also set on the LV or VG. See tags/hosttags. If any host tags exist but volume_list is not defined, a default single-entry list containing '@*' is assumed. # Example auto_activation_volume_list = [ "vg1", "vg2/lvol1", "@tag1", "@*" ] # LVs in this list are activated in read-only mode. If this list is defined, each LV that is to be activated is checked against this list, and if it matches, it is activated in read-only mode. This overrides the permission setting stored in the metadata, e.g. from --permission rw. # Accepted values: vgname The VG name is matched exactly and selects all LVs in the VG. vgname/lvname The VG name and LV name are matched exactly and selects the LV. @tag Selects an LV if the specified tag matches a tag set on the LV or VG. @* Selects an LV if a tag defined on the host is also set on the LV or VG. See tags/hosttags. If any host tags exist but volume_list is not defined, a default single-entry list containing '@*' is assumed. # Example read_only_volume_list = [ "vg1", "vg2/lvol1", "@tag1", "@*" ] # This has been replaced by the activation/raid_region_size setting. Size in KiB of each raid or mirror synchronization region. Size in KiB of each raid or mirror synchronization region. The clean/dirty state of data is tracked for each region. The value is rounded down to a power of two if necessary, and is ignored if it is not a multiple of the machine memory page size. Return errors if a thin pool runs out of space. The --errorwhenfull option overrides this setting. When enabled, writes to thin LVs immediately return an error if the thin pool is out of data space. When disabled, writes to thin LVs are queued if the thin pool is out of space, and processed when the thin pool data space is extended. New thin pools are assigned the behavior defined here. Setting to use when there is no readahead setting in metadata. # Accepted values: none Disable readahead. auto Use default value chosen by kernel. # Defines how a device failure in a RAID LV is handled. This includes LVs that have the following segment types: raid1, raid4, raid5*, and raid6*. If a device in the LV fails, the policy determines the steps performed by dmeventd automatically, and the steps perfomed by the manual command lvconvert --repair --use-policies. Automatic handling requires dmeventd to be monitoring the LV. # Accepted values: warn Use the system log to warn the user that a device in the RAID LV has failed. It is left to the user to run lvconvert --repair manually to remove or replace the failed device. As long as the number of failed devices does not exceed the redundancy of the LV (1 device for raid4/5, 2 for raid6), the LV will remain usable. allocate Attempt to use any extra physical volumes in the VG as spares and replace faulty devices. # Defines how a device failure in a 'mirror' LV is handled. An LV with the 'mirror' segment type is composed of mirror images (copies) and a mirror log. A disk log ensures that a mirror LV does not need to be re-synced (all copies made the same) every time a machine reboots or crashes. If a device in the LV fails, this policy determines the steps perfomed by dmeventd automatically, and the steps performed by the manual command lvconvert --repair --use-policies. Automatic handling requires dmeventd to be monitoring the LV. # Accepted values: remove Simply remove the faulty device and run without it. If the log device fails, the mirror would convert to using an in-memory log. This means the mirror will not remember its sync status across crashes/reboots and the entire mirror will be re-synced. If a mirror image fails, the mirror will convert to a non-mirrored device if there is only one remaining good copy. allocate Remove the faulty device and try to allocate space on a new device to be a replacement for the failed device. Using this policy for the log is fast and maintains the ability to remember sync state through crashes/reboots. Using this policy for a mirror device is slow, as it requires the mirror to resynchronize the devices, but it will preserve the mirror characteristic of the device. This policy acts like 'remove' if no suitable device and space can be allocated for the replacement. allocate_anywhere Not yet implemented. Useful to place the log device temporarily on the same physical volume as one of the mirror images. This policy is not recommended for mirror devices since it would break the redundant nature of the mirror. This policy acts like 'remove' if no suitable device and space can be allocated for the replacement. # Defines how a device failure in a 'mirror' log LV is handled. The mirror_image_fault_policy description for mirrored LVs also applies to mirrored log LVs. This has been replaced by the activation/mirror_image_fault_policy setting. Define how a device failure affecting a mirror is handled. Auto-extend a snapshot when its usage exceeds this percent. Setting this to 100 disables automatic extension. The minimum value is 50 (a smaller value is treated as 50.) Also see snapshot_autoextend_percent. Automatic extension requires dmeventd to be monitoring the LV. # Example Using 70% autoextend threshold and 20% autoextend size, when a 1G snapshot exceeds 700M, it is extended to 1.2G, and when it exceeds 840M, it is extended to 1.44G: snapshot_autoextend_threshold = 70 # Auto-extending a snapshot adds this percent extra space. The amount of additional space added to a snapshot is this percent of its current size. # Example Using 70% autoextend threshold and 20% autoextend size, when a 1G snapshot exceeds 700M, it is extended to 1.2G, and when it exceeds 840M, it is extended to 1.44G: snapshot_autoextend_percent = 20 # thin_pool_autoextend_thresholdAuto-extend a thin pool when its usage exceeds this percent. Setting this to 100 disables automatic extension. The minimum value is 50 (a smaller value is treated as 50.) Also see thin_pool_autoextend_percent. Automatic extension requires dmeventd to be monitoring the LV. # Example Using 70% autoextend threshold and 20% autoextend size, when a 1G thin pool exceeds 700M, it is extended to 1.2G, and when it exceeds 840M, it is extended to 1.44G: thin_pool_autoextend_threshold = 70 # Auto-extending a thin pool adds this percent extra space. The amount of additional space added to a thin pool is this percent of its current size. # Example Using 70% autoextend threshold and 20% autoextend size, when a 1G thin pool exceeds 700M, it is extended to 1.2G, and when it exceeds 840M, it is extended to 1.44G: thin_pool_autoextend_percent = 20 # Auto-extend a VDO pool when its usage exceeds this percent. Setting this to 100 disables automatic extension. The minimum value is 50 (a smaller value is treated as 50.) Also see vdo_pool_autoextend_percent. Automatic extension requires dmeventd to be monitoring the LV. # Example Using 70% autoextend threshold and 20% autoextend size, when a 10G VDO pool exceeds 7G, it is extended to 12G, and when it exceeds 8.4G, it is extended to 14.4G: vdo_pool_autoextend_threshold = 70 # Auto-extending a VDO pool adds this percent extra space. The amount of additional space added to a VDO pool is this percent of its current size. # Example Using 70% autoextend threshold and 20% autoextend size, when a 10G VDO pool exceeds 7G, it is extended to 12G, and when it exceeds 8.4G, it is extended to 14.4G: Do not mlock these memory areas. While activating devices, I/O to devices being (re)configured is suspended. As a precaution against deadlocks, LVM pins memory it is using so it is not paged out, and will not require I/O to reread. Groups of pages that are known not to be accessed during activation do not need to be pinned into memory. Each string listed in this setting is compared against each line in /proc/self/maps, and the pages corresponding to lines that match are not pinned. On some systems, locale-archive was found to make up over 80% of the memory used by the process. # Example mlock_filter = [ "locale/locale-archive", "gconv/gconv-modules.cache" ] # Use the old behavior of mlockall to pin all memory. Prior to version 2.02.62, LVM used mlockall() to pin the whole process's memory while activating devices. Monitor LVs that are activated. The --ignoremonitoring option overrides this setting. When enabled, LVM will ask dmeventd to monitor activated LVs. Check pvmove or lvconvert progress at this interval (seconds). When pvmove or lvconvert must wait for the kernel to finish synchronising or merging data, they check and report progress at intervals of this number of seconds. If this is set to 0 and there is only one thing to wait for, there are no progress reports, but the process is awoken immediately once the operation is complete. Set the activation skip flag on new thin snapshot LVs. The --setactivationskip option overrides this setting. An LV can have a persistent 'activation skip' flag. The flag causes the LV to be skipped during normal activation. The lvchange/vgchange -K option is required to activate LVs that have the activation skip flag set. When this setting is enabled, the activation skip flag is set on new thin snapshot LVs. How LVs with missing devices are activated. The --activationmode option overrides this setting. # Accepted values: complete Only allow activation of an LV if all of the Physical Volumes it uses are present. Other PVs in the Volume Group may be missing. degraded Like complete, but additionally RAID LVs of segment type raid1, raid4, raid5, radid6 and raid10 will be activated if there is no data loss, i.e. they have sufficient redundancy to present the entire addressable range of the Logical Volume. partial Allows the activation of any LV even if a missing or failed PV could cause data loss with a portion of the LV inaccessible. This setting should not normally be used, but may sometimes assist with data recovery. # Locking is started only for VGs selected by this list. The rules are the same as those for volume_list. Locking is auto-started only for VGs selected by this list. The rules are the same as those for auto_activation_volume_list. Check device sizes are not smaller than corresponding PV sizes. If device size is less than corresponding PV size found in metadata, there is always a risk of data loss. If this option is set, then LVM issues a warning message each time it finds that the device size is less than corresponding PV size. You should not disable this unless you are absolutely sure about what you are doing! When enabled, LVM keeps history records about removed LVs in metadata. The information that is recorded in metadata for historical LVs is reduced when compared to original information kept in metadata for live LVs. Currently, this feature is supported for thin and thin snapshot LVs only. Retention time in seconds after which a record about individual historical logical volume is automatically destroyed. A value of 0 disables this feature. Number of copies of metadata to store on each PV. The --pvmetadatacopies option overrides this setting. # Accepted values: 2 Two copies of the VG metadata are stored on the PV, one at the front of the PV, and one at the end. 1 One copy of VG metadata is stored at the front of the PV. 0 No copies of VG metadata are stored on the PV. This may be useful for VGs containing large numbers of PVs. # Number of copies of metadata to maintain for each VG. The --vgmetadatacopies option overrides this setting. If set to a non-zero value, LVM automatically chooses which of the available metadata areas to use to achieve the requested number of copies of the VG metadata. If you set a value larger than the the total number of metadata areas available, then metadata is stored in them all. The value 0 (unmanaged) disables this automatic management and allows you to control which metadata areas are used at the individual PV level using pvchange --metadataignore y|n. The default size of the metadata area in units of 512 byte sectors. The metadata area begins at an offset of the page size from the start of the device. The first PE is by default at 1 MiB from the start of the device. The space between these is the default metadata area size. The actual size of the metadata area may be larger than what is set here due to default_data_alignment making the first PE a MiB multiple. The metadata area begins with a 512 byte header and is followed by a circular buffer used for VG metadata text. The maximum size of the VG metadata is about half the size of the metadata buffer. VGs with large numbers of PVs or LVs, or VGs containing complex LV structures, may need additional space for VG metadata. The --metadatasize option overrides this setting. Ignore metadata areas on a new PV. The --metadataignore option overrides this setting. If metadata areas on a PV are ignored, LVM will not store metadata in them. Format of LVM command's report output. If there is more than one report per command, then the format is applied for all reports. You can also change output format directly on command line using --reportformat option which has precedence over log/output_format setting. Accepted values: basic Original format with columns and rows. If there is more than one report per command, each report is prefixed with report's name for identification. json JSON format. Do not print empty values for all report fields. If enabled, all fields that don't have a value set for any of the rows reported are skipped and not printed. Compact output is applicable only if report/buffered is enabled. If you need to compact only specified fields, use compact_output=0 and define report/compact_output_cols configuration setting instead. Do not print empty values for specified report fields. If defined, specified fields that don't have a value set for any of the rows reported are skipped and not printed. Compact output is applicable only if report/buffered is enabled. If you need to compact all fields, use compact_output=1 instead in which case the compact_output_cols setting is then ignored. Align columns in report output. Buffer report output. When buffered reporting is used, the report's content is appended incrementally to include each object being reported until the report is flushed to output which normally happens at the end of command execution. Otherwise, if buffering is not used, each object is reported as soon as its processing is finished. Show headings for columns on report. A separator to use on report after each field. A separator to use for list items when reported. Use a field name prefix for each field reported. Quote field values when using field name prefixes. Output each column as a row. If set, this also implies report/prefixes=1. Use binary values 0 or 1 instead of descriptive literal values. For columns that have exactly two valid values to report (not counting the 'unknown' value which denotes that the value could not be determined). Set time format for fields reporting time values. Format specification is a string which may contain special character sequences and ordinary character sequences. Ordinary character sequences are copied verbatim. Each special character sequence is introduced by the '%' character and such sequence is then substituted with a value as described below. # Accepted values: %a The abbreviated name of the day of the week according to the current locale. %A The full name of the day of the week according to the current locale. %b The abbreviated month name according to the current locale. %B The full month name according to the current locale. %c The preferred date and time representation for the current locale (alt E) %C The century number (year/100) as a 2-digit integer. (alt E) %d The day of the month as a decimal number (range 01 to 31). (alt O) %D Equivalent to %m/%d/%y. (For Americans only. Americans should note that in other countries%d/%m/%y is rather common. This means that in international context this format is ambiguous and should not be used. %e Like %d, the day of the month as a decimal number, but a leading zero is replaced by a space. (alt O) %E Modifier: use alternative local-dependent representation if available. %F Equivalent to %Y-%m-%d (the ISO 8601 date format). %G The ISO 8601 week-based year with century as adecimal number. The 4-digit year corresponding to the ISO week number (see %V). This has the same format and value as %Y, except that if the ISO week number belongs to the previous or next year, that year is used instead. %g Like %G, but without century, that is, with a 2-digit year (00-99). %h Equivalent to %b. %H The hour as a decimal number using a 24-hour clock (range 00 to 23). (alt O) %I The hour as a decimal number using a 12-hour clock (range 01 to 12). (alt O) %j The day of the year as a decimal number (range 001 to 366). %k The hour (24-hour clock) as a decimal number (range 0 to 23); single digits are preceded by a blank. (See also %H.) %l The hour (12-hour clock) as a decimal number (range 1 to 12); single digits are preceded by a blank. (See also %I.) %m The month as a decimal number (range 01 to 12). (alt O) %M The minute as a decimal number (range 00 to 59). (alt O) %O Modifier: use alternative numeric symbols. %p Either "AM" or "PM" according to the given time value, or the corresponding strings for the current locale. Noon is treated as "PM" and midnight as "AM". %P Like %p but in lowercase: "am" or "pm" or a corresponding string for the current locale. %r The time in a.m. or p.m. notation. In the POSIX locale this is equivalent to %I:%M:%S %p. %R The time in 24-hour notation (%H:%M). For a version including the seconds, see %T below. %s The number of seconds since the Epoch, 1970-01-01 00:00:00 +0000 (UTC) %S The second as a decimal number (range 00 to 60). (The range is up to 60 to allow for occasional leap seconds.) (alt O) %t A tab character. %T The time in 24-hour notation (%H:%M:%S). %u The day of the week as a decimal, range 1 to 7, Monday being 1. See also %w. (alt O) %U The week number of the current year as a decimal number, range 00 to 53, starting with the first Sunday as the first day of week 01. See also %V and %W. (alt O) %V The ISO 8601 week number of the current year as a decimal number, range 01 to 53, where week 1 is the first week that has at least 4 days in the new year. See also %U and %W. (alt O) %w The day of the week as a decimal, range 0 to 6, Sunday being 0. See also %u. (alt O) %W The week number of the current year as a decimal number, range 00 to 53, starting with the first Monday as the first day of week 01. (alt O) %x The preferred date representation for the current locale without the time. (alt E) %X The preferred time representation for the current locale without the date. (alt E) %y The year as a decimal number without a century (range 00 to 99). (alt E, alt O) %Y The year as a decimal number including the century. (alt E) %z The +hhmm or -hhmm numeric timezone (that is, the hour and minute offset from UTC). %Z The timezone name or abbreviation. %% A literal '%' character. # List of columns to sort by when reporting 'lvm devtypes' command. See 'lvm devtypes -o help' for the list of possible fields. devtype_name,devtype_max_partitions,devtype_descriptionList of columns to report for 'lvm devtypes' command. See 'lvm devtypes -o help' for the list of possible fields. List of columns to report for 'lvm devtypes' command in verbose mode. See 'lvm devtypes -o help' for the list of possible fields. List of columns to sort by when reporting 'lvs' command. See 'lvs -o help' for the list of possible fields. lv_name,vg_name,lv_attr,lv_size,pool_lv,origin,data_percent,metadata_percent,move_pv,mirror_log,copy_percent,convert_lvList of columns to report for 'lvs' command. See 'lvs -o help' for the list of possible fields. lv_name,vg_name,seg_count,lv_attr,lv_size,lv_major,lv_minor,lv_kernel_major,lv_kernel_minor,pool_lv,origin,data_percent,metadata_percent,move_pv,copy_percent,mirror_log,convert_lv,lv_uuid,lv_profileList of columns to report for 'lvs' command in verbose mode. See 'lvs -o help' for the list of possible fields. List of columns to sort by when reporting 'vgs' command. See 'vgs -o help' for the list of possible fields. vg_name,pv_count,lv_count,snap_count,vg_attr,vg_size,vg_freeList of columns to report for 'vgs' command. See 'vgs -o help' for the list of possible fields. vg_name,vg_attr,vg_extent_size,pv_count,lv_count,snap_count,vg_size,vg_free,vg_uuid,vg_profileList of columns to report for 'vgs' command in verbose mode. See 'vgs -o help' for the list of possible fields. List of columns to sort by when reporting 'pvs' command. See 'pvs -o help' for the list of possible fields. pv_name,vg_name,pv_fmt,pv_attr,pv_size,pv_freeList of columns to report for 'pvs' command. See 'pvs -o help' for the list of possible fields. pv_name,vg_name,pv_fmt,pv_attr,pv_size,pv_free,dev_size,pv_uuidList of columns to report for 'pvs' command in verbose mode. See 'pvs -o help' for the list of possible fields. List of columns to sort by when reporting 'lvs --segments' command. See 'lvs --segments -o help' for the list of possible fields. lv_name,vg_name,lv_attr,stripes,segtype,seg_sizeList of columns to report for 'lvs --segments' command. See 'lvs --segments -o help' for the list of possible fields. lv_name,vg_name,lv_attr,seg_start,seg_size,stripes,segtype,stripesize,chunksizeList of columns to report for 'lvs --segments' command in verbose mode. See 'lvs --segments -o help' for the list of possible fields. List of columns to sort by when reporting 'pvs --segments' command. See 'pvs --segments -o help' for the list of possible fields. pv_name,vg_name,pv_fmt,pv_attr,pv_size,pv_free,pvseg_start,pvseg_sizepv_name,vg_name,pv_fmt,pv_attr,pv_size,pv_free,pvseg_start,pvseg_size,lv_name,seg_start_pe,segtype,seg_pe_rangesList of columns to sort by when reporting 'pvs --segments' command in verbose mode. See 'pvs --segments -o help' for the list of possible fields. List of columns to report for lvm fullreport's 'vgs' subreport. See 'vgs -o help' for the list of possible fields. List of columns to report for lvm fullreport's 'vgs' subreport. See 'pvs -o help' for the list of possible fields. List of columns to report for lvm fullreport's 'lvs' subreport. See 'lvs -o help' for the list of possible fields. List of columns to report for lvm fullreport's 'pvseg' subreport. See 'pvs --segments -o help' for the list of possible fields. List of columns to report for lvm fullreport's 'seg' subreport. See 'lvs --segments -o help' for the list of possible fields. List of columns to sort by when reporting lvm fullreport's 'vgs' subreport. See 'vgs -o help' for the list of possible fields. List of columns to sort by when reporting lvm fullreport's 'vgs' subreport. See 'pvs -o help' for the list of possible fields. List of columns to sort by when reporting lvm fullreport's 'lvs' subreport. See 'lvs -o help' for the list of possible fields. List of columns to sort by when reporting for lvm fullreport's 'pvseg' subreport. See 'pvs --segments -o help' for the list of possible fields. List of columns to sort by when reporting lvm fullreport's 'seg' subreport. See 'lvs --segments -o help' for the list of possible fields. Use brackets [] to mark hidden devices. Use the two words 'unknown device' in place of '[unknown]'. This is displayed when the device for a PV is not known. libdevmapper-event-lvm2mirror.soThe library dmeventd uses when monitoring a mirror device. libdevmapper-event-lvm2mirror.so attempts to recover from failures. It removes failed devices from a volume group and reconfigures a mirror as necessary. If no mirror library is provided, mirrors are not monitored through dmeventd. libdevmapper-event-lvm2raid.solibdevmapper-event-lvm2snapshot.soThe library dmeventd uses when monitoring a snapshot device. libdevmapper-event-lvm2snapshot.so monitors the filling of snapshots and emits a warning through syslog when the usage exceeds 80%. The warning is repeated when 85%, 90% and 95% of the snapshot is filled. libdevmapper-event-lvm2thin.soThe library dmeventd uses when monitoring a thin device. libdevmapper-event-lvm2thin.so monitors the filling of a pool and emits a warning through syslog when the usage exceeds 80%. The warning is repeated when 85%, 90% and 95% of the pool is filled. The plugin runs command with each 5% increment when thin-pool data volume or metadata volume gets above 50%. Command which starts with 'lvm ' prefix is internal lvm command. You can write your own handler to customise behaviour in more details. User handler is specified with the full path starting with '/'. The library dmeventd uses when monitoring a VDO pool device. libdevmapper-event-lvm2vdo.so monitors the filling of a pool and emits a warning through syslog when the usage exceeds 80%. The warning is repeated when 85%, 90% and 95% of the pool is filled. The plugin runs command with each 5% increment when VDO pool volume gets above 50%. Command which starts with 'lvm ' prefix is internal lvm command. You can write your own handler to customise behaviour in more details. User handler is specified with the full path starting with '/'. The full path to the dmeventd binary. Create a host tag using the machine name. The machine name is nodename returned by uname(2). Replace this subsection name with a custom tag name. Multiple subsections like this can be created. The '@' prefix for tags is optional. This subsection can contain host_list, which is a list of machine names. If the name of the local machine is found in host_list, then the name of this subsection is used as a tag and is applied to the local machine as a 'host tag'. If this subsection is empty (has no host_list), then the subsection name is always applied as a 'host tag'. # Example The host tag foo is given to all hosts, and the host tag bar is given to the hosts named machine1 and machine2. tags { foo { } bar { host_list = [ "machine1", "machine2" ] } } # A list of machine names. These machine names are compared to the nodename returned by uname(2). If the local machine name matches an entry in this list, the name of the subsection is applied to the machine as a 'host tag'. Defines the local system ID for lvmlocal mode. This is used when global/system_id_source is set to 'lvmlocal' in the main configuration file, e.g. lvm.conf. When used, it must be set to a unique value among all hosts sharing access to the storage, e.g. a host name. # Example Set no system ID: system_id = "" Set the system_id to a specific name: system_id = "host1" # A list of extra VG system IDs the local host can access. VGs with the system IDs listed here (in addition to the host's own system ID) can be fully accessed by the local host. (These are system IDs that the host sees in VGs, not system IDs that identify the local host, which is determined by system_id_source.) Use this only after consulting 'man lvmsystemid' to be certain of correct usage and possible dangers. The lvmlockd sanlock host_id. This must be unique among all hosts, and must be between 1 and 2000. Applicable only if LVM is compiled with lockd support <#config/config.cSetting %s to %soption%s# Configuration %s %s. %s# %s%s#%s%s string float integer boolean section array with values of type: - %s%s%s%s%s%s%s # Failed to duplicate filename.%s is not a regular file%s is emptyreadconfig_tree allocation failedLoading config file: %sFailed to load config file %sstdoutDumping configuration to %sFailure while writing to %scommand profilemetadata profileUndefined profile name.profile allocation failed%s/%s.profileIgnoring invalid %s %s.%s%s%s/%s.cache%s/%s/%s.cache(root)How LVM uses block devices. shellHost tag settings. abort_on_errorsprofile_dir#S/devloopfilesobtain_device_list_from_udevexternal_device_info_sourcepreferred_namesuse_devicesfilesystem.devicessearch_for_devnames#Sa|.*|global_filtercache_dircache_file_prefixwrite_cache_statesysfs_scanscan_lvsmultipath_component_detectionmultipath_wwids_file/etc/multipath/wwidsmd_component_detectionmd_component_checksfw_raid_component_detectionmd_chunk_alignmentdefault_data_alignmentdata_alignment_detectionignore_suspended_devicesignore_lvm_mirrorsdisable_after_error_countrequire_restorefile_with_uuidpv_min_sizeissue_discardsallow_mixed_block_sizescling_tag_listmaximise_clinguse_blkid_wiping@DEFAULT_USE_BLKID_WIPING@raid_stripe_all_devicescache_pool_cachemodeCache mode. cache_metadata_formatcache_pool_chunk_sizecache_pool_max_chunksthin_pool_crop_metadatathin_pool_zerothin_pool_discardsthin_pool_chunk_size_policygenericzero_metadatathin_pool_chunk_sizephysical_extent_sizevdo_use_compressionvdo_use_deduplicationvdo_use_metadata_hintsvdo_minimum_io_sizevdo_block_map_cache_size_mbvdo_block_map_periodvdo_check_point_frequencyvdo_use_sparse_indexvdo_index_memory_size_mbvdo_slab_size_mbvdo_ack_threadsvdo_bio_threadsvdo_bio_rotationvdo_cpu_threadsvdo_hash_zone_threadsvdo_logical_threadsvdo_physical_threadsvdo_write_policyvdo_max_discardreport_command_logcommand_log_sortlog_seq_numcommand_log_colscommand_log_selectionsilentsyslogoverwritelevelindentcommand_namesactivate_filedebug_classesbackup_dirarchive_dirretain_minretain_dayshistory_sizeumasksi_unit_consistencyfallback_to_lvm1format_librariessegment_libraries/procLocation of proc filesystem. /etc@CONFDIR@locking_typewait_for_locksfallback_to_clustered_lockingfallback_to_local_lockinglocking_dir/run/lock/lvm@DEFAULT_LOCK_DIR@prioritise_write_lockslibrary_dirlocking_libraryliblvm2clusterlock.soabort_on_internal_errorsmetadata_read_onlymirror_segtype_default@DEFAULT_MIRROR_SEGTYPE@support_mirrored_mirror_lograid10_segtype_defaultraid10@DEFAULT_RAID10_SEGTYPE@sparse_segtype_default@DEFAULT_SPARSE_SEGTYPE@event_activationuse_lvmetadlvmetad_update_wait_timeuse_aiouse_lvmlockdlvmlockd_lock_retriessanlock_lv_extendlvmlockctl_kill_commandthin_check_executable/usr/sbin/thin_check@THIN_CHECK_CMD@thin_dump_executable/usr/sbin/thin_dump@THIN_DUMP_CMD@thin_repair_executable/usr/sbin/thin_repair@THIN_REPAIR_CMD@thin_check_optionsthin_repair_options#Sthin_disabled_featurescache_disabled_featurescache_check_executable/usr/sbin/cache_check@CACHE_CHECK_CMD@cache_dump_executable/usr/sbin/cache_dump@CACHE_DUMP_CMD@cache_repair_executable/usr/sbin/cache_repair@CACHE_REPAIR_CMD@cache_check_optionscache_repair_optionsvdo_format_executable/usr/bin/vdoformat@VDO_FORMAT_CMD@vdo_format_optionsvdo_disabled_featuresfsadm_executable/usr/sbin/fsadm@FSADM_PATH@system_id_sourcesystem_id_fileuse_lvmpolld@DEFAULT_USE_LVMPOLLD@notify_dbusio_memory_sizeudev_syncudev_rulesverify_udev_operationsretry_deactivationmissing_stripe_filleruse_linear_targetreserved_stackreserved_memoryprocess_priorityauto_activation_volume_listread_only_volume_listmirror_region_sizeraid_region_sizeraid_fault_policywarnmirror_image_fault_policymirror_log_fault_policyallocatemirror_device_fault_policysnapshot_autoextend_thresholdsnapshot_autoextend_percentthin_pool_autoextend_percentvdo_pool_autoextend_thresholdvdo_pool_autoextend_percentmlock_filteruse_mlockallpolling_intervalauto_set_activation_skipactivation_modedegradedauto_lock_start_listcheck_pv_device_sizesrecord_lvs_historylvs_history_retention_timepvmetadatasizepvmetadataignoredirsdisk_areasdisk_areastart_sectoroutput_formatbasiccompact_outputcompact_output_colslist_item_separator,columns_as_rowsbinary_values_as_numerictime_format%Y-%m-%d %T %zdevtypes_sortdevtype_namedevtypes_colsdevtypes_cols_verboselvs_sortvg_name,lv_namelvs_colslvs_cols_verbosevgs_sortvg_namevgs_colsvgs_cols_verbosepvs_sortpv_namepvs_colspvs_cols_verbosevg_name,lv_name,seg_startpvsegs_sortpv_name,pvseg_startpvsegs_colspvsegs_cols_verbosevgs_cols_fullvg_allpvs_cols_fullpv_alllvs_cols_fulllv_allpvsegs_cols_fullpvseg_all,pv_uuid,lv_uuidseg_all,lv_uuidvgs_sort_fullpvs_sort_fulllvs_sort_fullpvsegs_sort_fullpv_uuid,pvseg_startlv_uuid,seg_startmark_hidden_devicestwo_word_unknown_devicemirror_libraryraid_librarysnapshot_librarythin_librarylvm lvextend --use-policiesvdo_librarylibdevmapper-event-lvm2vdo.so/usr/sbin/dmeventd@DMEVENTD_PATH@hosttagssystem_idextra_system_idshost_idundefinedmerged filesspecial purpose84(4848438484843848484848484843848484848484848484848484848484h3IHHIH|HGGG4datastruct/btree.cstr_list allocation faileddatastruct/str_list.cstr_list_to_str: string allocation failed.str_to_str_list: string list allocation failed.str_to_str_list: string list item allocation failed.WARNING: %s failed: %s.device/bcache.cmisaligned data bufferio_destroyunable to allocate sync_ioio_geteventsio_setup failed %dsome blocks are still lockedCannot extend bcache fd tableLimit write at %llu len %llu beyond last byte %lluSkip extending write at %llu len %llu limit %llu extra %llu sector_size %lluLimit write at %llu len %llu to len %llu rounded to %lluLimit write at %llu len %llu to len %lluInvalid adjusted write at %llu len %llu adjusted %llu limit %llu extra %llu sector_size %llucouldn't allocate control blockWARNING: bcache_invalidate: block (%d, %llu) still dirty.WARNING: bcache_invalidate: block (%d, %llu) still held.bcache_abort: block (%d, %llu) still heldWARNING: async io still in flight.Device seek error %d for offset %lluDevice seek failed for offset %lluDevice read error %d offset %llu len %lluDevice write error %d offset %llu len %lluDevice read short %u bytes remainingDevice write short %u bytes remainingbcache no new blocks for di %d index %u with >%d errors.bcache no new blocks for di %d index %ubcache unable to insert block in radix tree (OOM?)_SC_PAGESIZE returns negative value.couldn't create control block setWARNING: _SC_PAGESIZE returns negative value.bcache must have at least one cache blockbcache must have a non zero block sizebcache block size must be a multiple of page sizeconcurrent write lock attemptedbcache failed to get block %u di %dref count on bcache block already zerobcache_invalidate: block (%d, %llu) still heldInternal error: Cannot change not opened DI with FD:%dDrop alias for %d:%d %s.device/dev-cache.cdisk/lstatfilename strdup failed%s: New preferred namefgets%sdev/block/%d:%d/dm/uuidIgnoring %s: %s.Ignoring %s: Not a directory.dir_list allocation failedNo devno %d:%d in dev cache.dev_iter allocation failed/dev/nvmeFound nvme device %sFound dev %d:%d %s - new.Dir path %s is too longPath %s/%s is too long.%s: Not available device node%sdev/block/%d:%d/holders/opendir%sblock/%s/devclosedir%sdev/blockFailed to udev_enumerate_new.not found in configdev_cachestrdup dev_dir failed.preferred device name matcherNot a block device %s.Failed to get device %s%s/devices/dmeventd.devicesFailed to copy devices path%s/devicesCreating %s.Failed to create %s %d%s/devices/%sDevices file not found: %spvcreatevgcreateCannot access device %s.Invaild device type %s.%s: failed to allocate device list for device cache index.%s: failed to insert device list to device cache index.struct device allocation failedstruct dm_str_list allocation failed_get_sysfs_value: %s: no value%d:%d: dm_snprintf failed for path to sysfs dm directory.Drop alias for %d:%d invalid path %s %d:%d.Failed to add allias to dev cache.Couldn't add name to hash in dev cache.Found dev %d:%d %s - exists. %.8sCouldn't insert device into binary tree.Found dev %d:%d %s - new alias.Found dev %d:%d %s - existing device, path was previously %d:%d.Found dev %d:%d %s - new device, path was previously %d:%d.Found dev %d:%d %s - failed to use.%s: Symbolic link to directory%s: Different filesystem in directory_insert_sysfs_dev: %s: dm_snprintf failedCouldn't add device to binary tree of sysfs-only devices in dev cache.%s: dm_snprintf failed for path to holders directory.%s: path does not exist, skipping%s: dm_snprintf failed for holder %s device path._get_device_for_sysfs_dev_name_using_devno: %s: dm_snprintf failed_get_device_for_sysfs_dev_name_using_devno: %s: failed to get major and minor number%s: failed to find associated device structure for holder %s.%s: failed to allocate dev list item.dev_cache_index_devs: dm_snprintf failed._dev_cache_iterate_sysfs_for_index: %s: failed to get major and minor numberCreating list of system devices.WARNING: Cannot use dir %s, %s.Failed to udev_enumerate_add_match_subsystem.Failed to udev_enumerate_scan_devices.udev failed to return a device for entry %s.udev failed to return a device node for entry %s.udev failed to return a symlink name for entry %s.%s: Failed to insert devices from udev-managed directory to device cache fully%s: Failed to insert devices to device cache fullyDevice '%s' has been left open (%d remaining references).Internal error: %d device(s) were left open and have been closed.Couldn't create binary tree for dev-cache.Couldn't create binary tree for sysfs-only devices in dev cache.devices/preferred_names %s: using built-in preferencespreferred_names patterns must be enclosed in quotesFailed to allocate preferred device name pattern list.Failed to allocate a preferred device name pattern.Preferred device name pattern matcher creation failed.Ignoring dev with no valid paths for %s.Device path %s is invalid for %d:%d %s.Dropping aliases for device entry %d:%d %s for new device %d:%d %s.Dropping aliases for %d:%d before adding new path %s.dev_cache_get filter deferred %sdev_cache_get filter excludes %sget device by iter defer filter %sInvalid devices file name from config setting "%s".Failed to copy devices dir pathFailed to copy devices file pathFailed to lock the devices file to create.Failed to lock the devices file.Failed to read the devices file.Devices file not found, ignoring.Failed to lock the devices file to read.part%sdev/block/%d:%d/%sdevice/device_id.c%s/D_%s/run/lvm/searched_devnamesunlink %s errno %dunlink %sCRYPT-device/serialmpath-md/uuidloop/backing_filesys_wwidsys_serialdevnamempath_uuidcrypt_uuidlvmlv_uuidmd_uuidloop_fileQEMU HARDDISK(deleted)No idtype %s for %s/dev/mapper/Match device_id %s %s to %s/dev/dm-device_ids_read already donedevice_ids_read %sSYSTEMIDread devices file systemid %sVERSIONread devices file version %sIDTYPEIDNAMEDEVNAMEPVIDPARTmissing deviceDevice not added.Device not found for %s.Creating devices file %s%s_neww+SYSTEMID=%s VERSION=%u.%u.%uWrote devices file %sDevices file update skipped.Drop incorrectly matched %sSearch for PVID %s.stat %s errno %dSearch for PVIDs filtering.usablempathfwraidFailed to create sysfs path for %sWARNING: devices file already locked %dWARNING: devices file lock file already open %dlock_devices_file open errno %dlock_devices_file flock errno %dMatch device_id %s %s to %s: ignoring idname %sMatch device_id %s %s to %s: using other dm name, ignoring %sMatch device_id %s %s to %s: dm namesCannot open devices file to read.WARNING: devices file has unmatching system id %s vs local %s.WARNING: failed to process devices file entry.WARNING: cannot open devices file to read.check devices file version %s prev %sWARNING: ignoring unknown device_id type %s.WARNING: ignoring device_id name %s.WARNING: ignoring deviceidtype %s which is not available for device.Missing support for DRBD idtypedevice_id_add %s pvid %s matches entry %p dev %sdevice_id_add %s pvid %s matches entry %p dev %s with same pvid %sdevice_id_add %s pvid %s matches entry %p dev %s with same device_id %d %sdevice_id_add %s pvid %s matches entry %p dev %s with same devname %sWARNING: adding device %s with PVID %s which is already used for %s device_id %s.WARNING: adding device %s with idname %s which is already used for missing device.Using separate entries for partitions of same device %s part %d %s part %d.WARNING: adding device %s with idname %s which is already used for %s.Add device with duplicate PV to devices file?Adding new entry to devices file for %s PVID %s %s %s.Updating existing entry in devices file for %s that matches %s %s.WARNING: devices to use does not include %scompare devices file entries to devicesdevices idname %s previously matched %sdevices entry %s %s devname found but not matchedDevice %s not matched to device_idDevices file PVID %s last seen on %s not found.Devices file PVID %s not found.Devices file %s %s PVID %s last seen on %s not found.Devices file %s %s PVID %s not found.Cannot create devices file, missing devices directory %s.device_ids_write create %d edit %d pending %d exists %d version %s devicesfile %sNot creating system devices file due to existing VGs.WARNING: not updating devices file with unparsed version.WARNING: not updating devices file with larger major version.Cannot open tmp devices_file to write.# LVM uses devices listed in this file. # Created by LVM command %s pid %d at %sIDTYPE=%s IDNAME=%s DEVNAME=%s PVID=%s PART=%d IDTYPE=%s IDNAME=%s DEVNAME=%s PVID=%s Failed to replace devices file errno %dWARNING: devices file unlock no fdWARNING: devices file unlock not lockedWARNING: devices file unlock errno %ddevice_id update %s pvid %s vgid %s to %sSkip devices file update (busy).Skip devices file update (changed).validating devices file entriesDevices file %s is excluded: %s.Device %s has PVID %s (devices file %s)Device %s has no PVID (devices file %s)Device %s has updated name (devices file %s)du for pvid %s unexpected idname %s mismatch dev %sDevices file PVID %s not found on device %s (device PVID %s).Devices file PVID %s not found on device %s.device ids validate checked %d update disabled.device ids validate checked %d trying to update devices file.device ids validate checked %d found no update is needed.Search for PVIDs skipped for %sSearch for PVIDs reading labels on %d devs.WARNING: found PVID %s on multiple devices %s %s.WARNING: duplicate PVIDs should be changed to be unique.WARNING: use lvmdevices to select a device for PVID %s.Devices file PVID %s found on %s.Search for PVIDs other_pvid %d no_pvid %d other_idtype %d.Devices file PVID %s updating IDNAME to %s.WARNING: new device %s for PVID %s is excluded: %s.Search for PVIDs update disabledSearch for PVIDs updating devices fileSearch for PVIDs found no updatesdevice/dev-ext.cUdev database has incomplete information about device %s.%s: Failed to get external handle [%s].%s: External handle [%s:%p] attached%s: Failed to release external handle [%s:%p]%s: External handle [%s:%p] detached%s: Failed to enable external handle [%s].%s: Failed to disable external handle [%s].device/dev-io.cClosed %s O_EXCLRWRO%s: Not using O_NOATIME%s: Not using O_DIRECTOpened %s %s%s%s (test mode - suppressed)%s: size is %lu sectors%s: read_ahead is %u sectorsAttempt to close device '%s' which is not open.%s: Immediate close attempt while still referencedCannot open device %d:%d with no valid paths.%s: Already opened read-only. Upgrading to read-write.dev_open(%s) called while suspendedFailed to open device path %s (%d).%s: fstat failed: Has device name changed?Discarding %lu bytes offset %lu bytes on %s. %sWARNING: %s: ioctl BLKDISCARD at offset %lu size %lu failed: %s.%s: using cached size %lu sectorsWARNING: %s: ioctl BLKGETSIZE64 %sWARNING: Failed to open %s to get readahead %s.WARNING: %s: ioctl BLKRAGET %s.device/dev-md.c%s/dev/block/%d:%d/md/%sdm_snprintf md %s failed%s/block/md%d/md/%sdm_snprintf old md %s failedIntel Raid ISM Cfg Sig. ID_FS_TYPElinux_raid_memberDevice %s %s is %lu bytes.Device %s %s is %s.raid%draid_disksDevice %s %s is %d.metadata_version1.00.90Found md ddf magic at %llu wrong crc %x disk %x %s_md_sysfs_attribute_scanf fopen failed %s_md_sysfs_attribute_scanf fgets failed %s%s sysfs attr %s not in expected format: %sInternal error: dev_is_md_component_native requires io layer.Found md magic number at offset 0 of %s.Found md magic number at offset 4096 of %s.Found md magic number at offset %llu of %s.Found md imsm magic number at offset %llu of %s.Found md ddf magic number at offset %llu of %s.Device %s has an unknown md raid level: %dDevice %s stripe-width is %lu bytes.CC`D`DPDPD@D`D`D`DCIgnoring unknown multipath_wwids_file.multipath wwids file not foundmultipath wwids read %d from %smultipath config ignored %d wwidsSysfs path string is too long.Cannot find device name in sysfs path.Cannot find '/' in device name.Failed to get primary device for %d:%d.Sysfs path to check mpath is too long.dm device path to check mpath is too long.dev_is_mpath_component %s holder %s stat result %ddev_is_mpath_component %s holder %s %d:%d does not have dm majordev_is_mpath_component %s holder %s %u:%u already checked as %sbeing mpath.dev_is_mpath_component %s holder %s %u:%u ignore mpath componentmpath hash table creation failed.multipath wwids file disabled.dev_is_mpath_component %s no primary devdev_is_mpath_component %s %s in wwids fileSysfs path to check mpath components is too long.Failed to create sysfs wwid path for %sdevice/dev-mpath.cdevice/vpd_pg83blacklist_exceptionsblacklistmultipath wwid %s in %s %s/etc/multipath.conf/etc/multipath/conf.d/etc/multipath/conf.d/%snot %sdev/block/%d:%dreadlinkDevice name is not valid.%sblock/%s/holdersPath %s is not a directory.Device %s has no holders dir%sblock/%s/dm/uuidmpath pool creation failed.naa.eui.t10.unknown wwid type %smpath_memberDM_MULTIPATH_DEVICE_PATH%s/dev/block/%d:%d/slavesDevice %s has no slaves dir%s/block/%s/device/wwidscsi_debugdevice/dev-swap.cSWAP-SPACESWAPSPACE2S1SUSPENDS2SUSPENDULSUSPEND%s/dev/block/%d:%d/partitiondevice/dev-type.cAborted wiping of %s.Wiping %s on %s.Failed to wipe %s on %s.Failed to read %s.Failed to parse %s '%s'.%s/dev/block/%d:%d/%sblkextdrbddasdemcpowerVxDMPlooppower2device-mapperNVMEDMDRBDDASDEMCPOWERPOWER2VXDMPBLKEXTLOOP%sdev/block/%d:%d/partitionID_PART_TABLE_TYPEDEVTYPE%s/dev/block/%d:%d%s/block/%s/devsysfs file %s does not exist.Device %s: %s is %lu%s.BLOCK_SIZELVM2_memberLVM1_memberDM_snapshot_cowSBMAGIC_OFFSETSBMAGICPTTYPEPTMAGIC_OFFSETPTMAGICpartition tableUSAGELABELsoftware RAID md superblockswap signatureLUKS signaturealignment_offsetqueue/minimum_io_sizequeue/optimal_io_sizequeue/discard_max_bytesqueue/discard_granularityqueue/rotationalqueue/daxSCSI diskIDE diskMultiple Disk (MD/SoftRAID)Loop deviceRAM diskMapped devicePartitionable MDDAC960Network Block DeviceCompaq SMART2Compaq CCISS arrayATA RaidEMC Powerpathi2o Block DiskiSeries disksNetwork block deviceATA over EthernetXen virtual block devicePlayStation 3 internal diskVirtIO diskMMC block deviceExtended device partitionsFusion IOMicron PCIe SSDViolin MemorySTECbcache block device cacheNVM ExpressZFS ZvolsVeritas Dynamic MultipathingWARNING: %s: partition path is too long.Fatal error while trying to detect %s on %s.WARNING: %s detected on %s. Wipe it? [y/n]: %sdev/block/%d:%d/loop/partscanSysfs path for partscan is too long.WARNING: sysfs path for %s attribute is too long.Sysfs dm uuid path for %s is too long.Failed to allocate device type register.No proc filesystem found: using all block device typesFailed to create /proc/devices stringWARNING: /proc/devices line: %s, replacing major with %d.Expecting string in devices/types in config fileMax partition count missing for %s in devices/types in config fileZero partition count invalid for %s in devices/types in config fileFailed to read sysfs path for %sFailed to read sysfs partition value for %sInternal error: dev_is_partitioned_native requires i/o.WARNING: %s: major:minor sysfs path is too long.WARNING: Readlink of %s failed.WARNING: sysfs path for %s is too long.WARNING: sysfs file %s not in expected MAJ:MIN format: %sWARNING: sysfs file %s not in expected format: %sWARNING: Device %s: %s is %lu and is unexpectedly less than sector.Found blkid BLOCK_SIZE %u for fs on %sNo blkid BLOCK_SIZE for fs on %sFailed to create a new blkid probe for device %s.Failed to get offset of the %s signature on %s.WARNING: Failed to get offset of the %s signature on %s. Wiping skipped.Failed to get length of the %s signature on %s.WARNING: Failed to get length of the %s signature on %s. Wiping skipped.Found existing signature on %s at offset %s: LABEL="%s" UUID="%s" TYPE="%s" USAGE="%s"WARNING: %s signature detected on %s at offset %s. Wipe it? [y/n]: Failed to wipe %s signature on %s.Failed to step back blkid probe to check just wiped signature.%d existing signature%s left on the device.DASD disk (IBM S/390, zSeries)User-mode virtual block deviceDistributed Replicated Block Device (DRBD)SUN's LDOM virtual block deviceStorage Class Memory (IBM S/390)Wiping %s signature on %s.device/dev-luks.cLUKSdevice/dev-dasd.cioctl BIODASDINFO2t10.%seui.%snaa.%scling_by_tagsnext freedisplay/display.cclvm%.2fPercentage %d does not fit.--- Physical Segments ---Physical extent %u to %u: Logical volume %s%s/%s Logical extents %d to %d FREENEW (exported)(but full)--- %sPhysical volume ---PV Name %sVG Name %s%sPV Size %sAllocatable yes %sAllocatable NOPE Size %sPE Size (KByte) %uTotal PE %uFree PE %uAllocated PE %uPV UUID %sNOT PV Name %s Total PE / Free PE %u / %uread/writeread onlyINACTIVE (partial)LV Name %s%sVG Name %sLV UUID %sLV Creation time %sLV Removal time %s--- Logical volume ---LV Name %sInternal LV Name %sLV Write Access %sLV Creation host, time %s, %sLV Pool name %sLV Thin origin name %sLV External origin name %sLV merging to %sLV merged with %sLV Pool metadata %sLV Pool data %sLV origin of Cache LV %sLV Cache pool name %sLV Cache origin name %sLV VDO Pool data %sLV VDO Pool usage %s%%LV VDO Pool saving %s%%LV VDO Operating mode %sLV VDO Index state %sLV VDO Compression st %sLV VDO Used size %sLV VDO Pool name %s# open %uLV Size %sCache used blocks %s%%Cache metadata blocks %s%%Cache dirty blocks %s%%Cache demotions %luCache promotions %luAllocated pool data %s%%Allocated metadata %s%%Mapped size %s%%Current LE %uCOW-table size %sCOW-table LE %uAllocated to snapshot %s%%Snapshot chunk size %sMirrored volumes %uSegments %uAllocation %sRead ahead sectors autoRead ahead sectors 0Read ahead sectors %u- currently set to %uBlock device %d:%dPersistent minor %dPersistent major %dMissing%sPhysical volume %s%sPhysical extents %d to %d%sLogical volume %s%sLogical extents %d to %d%sUnassigned areaVirtualLogical--- Segments ---%s extents %u to %u: Type %s Monitoring %sexported/--- Volume group ---VG Name %sSystem ID %sFormat %sMetadata Areas %dMetadata Sequence No %dClustered yesShared %sMAX LV %uCur LV %uOpen LV %uMax PV %uCur PV %uAct PV %uVG Size %sAlloc PE / Size %u / %sFree PE / Size %u / %sVG UUID %sr/wName is zero length.WARNING: Invalid input '%s'.[n] Accepted input: [%c]PVSUnrecognised allocation policy %sFull LV name "%s/%s" is too long.%s:%s:%lu:-1:%lu:%lu:-1:%u:%u:%u:%u:%sPV Size %s / not usable %sPV Status %sallocatable%s%s/%s:%s:%lu:%d:-1:%d:%lu:%d:-1:%d:%d:%d:%dread/write (activated read only)--- Historical Logical volume ---LV Name %s%s/%sLV Path %s%s/%sLV snapshot status source of %s%s/%s [%s] %s [%s]LV snapshot status %s destination for %s%s/%sLV snapshot status %s destination for %sLV Status suspendedLV Status %savailable%sCache read hits/misses %lu / %luCache wrt hits/misses %lu / %luLV type Mirror undergoing conversionVG Access %s%s%s%sVG Status %s%sresizable%s:%s:%lu:-1:%u:%u:%u:-1:%u:%u:%u:%lu:%u:%u:%u:%u:%s"%s" %-9s [%-9s used / %s free]Name cannot start with hyphen.Name starts with . or .. and has no following character(s).Name contains invalid character, valid set includes: [a-zA-Z0-9.-_+].Name length exceeds maximum limit of %d.Internal error: Unknown error %d on name validation.yyyyyĩDnoyescontiguouscclinglcling_by_tagstnormalnanywhereainheritierror/errseg.cerroerror module string list allocation failedimporting unknown segmentunknown/unknown.cstart_extentFailed to allocate name.Failed to allocate memory for unknown segtypeInternal error: Destroying composite filter while in use %u times.Composite filters allocation failed.filters/filter-composite.ccompositeComposite filter initialised.Internal error: Destroying persistent filter while in use %u times.%d:%d: filter cache skipping (no name)%s: filter cache skipping (cached bad)%s: filter cache using (cached good)Failed to hash alias to filter.Allocation of persistent filter failed.Couldn't create hash table for persistent filter.Allocation of device filter for persistent filter failed.Persistent filter initialised.filters/filter-persistent.cgoodbadfilter cache deferred %sfilter caching %s %sInternal error: Destroying regex filter while in use %u times.Please remove the lvm.conf filter, it is ignored with the devices file.Please remove the lvm.conf global_filter, it is ignored with the devices file.Filter patterns must be enclosed in quotes.Pattern must begin with 'a' or 'r'.Invalid separator at end of regex.filters/filter-regex.c%s: Skipping (regex)filter regexfilter dm_regexFailed to allocate regex.Failed to create bitset.Invalid filter pattern "%s".Regex filter initialised.Internal error: Destroying sysfs filter while in use %u times.filter-sysfs disabled: /sys/dev/block not foundNo proc filesystem found: skipping sysfs filterfilters/filter-sysfs.cfailed to create sysfs path%s: Skipping (sysfs)Sysfs filter initialised.Internal error: Destroying md filter while in use %u times.md filter full %d excluding md component %s%s: Skipping md component device%s: Skipping md component device [%s:%p]%s: Skipping: error in md component detectionfilters/filter-md.cfilter md deferred %smd filter allocation failedMD filter initialised.Internal error: Destroying firmware RAID filter while in use %u times.%s: Firmware RAID detection is not supported by LVM natively. Skipping firmware raid detection. Internal error: Missing hook for firmware RAID recognition using external device info source %s%s: Skipping firmware RAID component device%s: Skipping firmware RAID component device [%s:%p]Firmware RAID filter allocation failedFirmware RAID filter initialised.filters/filter-fwraid.cInternal error: Destroying mpath filter while in use %u times.%s: Skipping mpath component deviceNo proc filesystem found: skipping multipath filtermpath filter allocation failedfilters/filter-mpath.cmpath filter initialised.Internal error: Destroying partitioned filter while in use %u times.filter partitioned deferred %s%s: Skipping: Partition table signature found%s: Skipping: Partition table signature found [%s:%p]Partitioned filter allocation failedPartitioned filter initialised.filters/filter-partitioned.cInternal error: Destroying lvm_type filter while in use %u times.%s: Skipping: Unrecognised LVM device type %luLVM type filter allocation failedfilters/filter-type.cLVM type filter initialised.Internal error: Destroying usable device filter while in use %u times.%s: Skipping: dev_get_size failedUsable device filter allocation failedUsable device filter mode allocation failedUsable device filter initialised (scan_lvs %d).filters/filter-usable.c%s: Skipping unusable device.%s: Skipping: %sToo small to hold a PVInternal error: Destroying internal filter while in use %u times.%s: Skipping for internal filtering.filters/filter-internal.cinternalInternal filter initialised.Internal error: Destroying signature filter while in use %u times.%s: Skipping: error in signature detectionfilters/filter-signature.c%s: Skipping lvm1 device%s: Skipping gfs-pool devicefilter signature deferred %ssignature filter initialised.Internal error: Destroying deviceid filter while in use %u times.deviceid filter allocation failedfilters/filter-deviceid.c%s: Skipping (deviceid)deviceiddeviceid filter initialised.format_text/archive.cFile: %sUnable to read archive file.VG name: %sDescription: %sBackup Time: %s%s/%s_%05u-%d.vgArchive file name too long.Expiring archive %sunlinkArchive rename failed for %sNo archives found in %s.Archive file %s not found.Created path %s/%s is too long.Couldn't create text instance object.Couldn't scan the archive directory (%s).Couldn't create new archive file.Couldn't create temporary archive name.Couldn't create FILE object for archive.Consider pruning %s VG archive with more then %u MiB in %u files (check archiving is needed in lvm.conf).Internal error: Passed file path name %s is too long.*before**after*Failed to allocate desc.format_text/archiver.cCreated %s executing '%s'Failed to build desc.archive_params alloc failedbackup_params alloc failedFailed to find device for PV.Zeroing start of device %s%s not wiped: abortingTest mode: Skipping archiving of volume group.Cannot archive volume group metadata for %s to read-only filesystem.Archiving volume group "%s" metadata (seqno %u).Couldn't copy archive directory name.Couldn't copy backup directory name.Failed to generate backup filename (for removal).Couldn't create text format object.Failed to setup physical volume "%s".Failed to allocate PV list item for "%s".Set up physical volume for "%s" with %lu available sectors.Failed to allocate format instance.Deleting existing metadata for VG %s.Removal of existing metadata for VG %s failed.Failed to duplicate empty name.Failed to find cached info for PV %s.Failed to allocate structure for scheduled writing of PV '%s'.Format-specific setup for %s failed.Failed to wipe existing label on %sConsider using option --force to restore Volume Group %s with thin volumes.WARNING: Forced restore of Volume Group %s with thin volumes.Cannot restore Volume Group %s with %i PVs marked as missing.Failed to generate backup filename (for restore).Creating volume group backup "%s" (seqno %u).Couldn't create backup object.Internal error: No in use metadata areas to write.Failed to generate volume group metadata backup filename.WARNING: This metadata update is NOT backed up.Test mode: Skipping backup of volume group.Skipping backup of volume group on read-only filesystem.Backup of volume group %s metadata failed.Skipping check for current backup, since backup is disabled.WARNING: Failed to generate backup pathname %s/%s.Internal error: problem tracking indentationDoubling metadata output buffer to %u# Generated by LVM2 version %s: %scontents = "Text Format Volume Group"creation_host = "%s" # %s %s %s %s %screation_host_system_id = "%s"Could not allocate memory for string list buffer.Internal error: PV name for uuid %s missing from text metadata export hash table.pv device name size is out of bounds.Could not allocate memory for ancestor list buffer.Internal error: Missing PV for area %u of %s segment of LV %s.RAID segment has non-RAID areasInternal error: Invalid type for area %u of %s segment of LV %s.text_export buffer allocation failedCould not format metadata for VG %s.Error parsing metadata for VG %s.format_text/export.cuname failed: %sBuffer reallocation failed.MegabytesKilobytes# %g %s# Hint only%s = %lustatus = %sflags = %s2.03.14(2)-RHEL8 (2021-10-20)version = %ddescription = "%s"creation_time = %lu # %s%s = %s%s {creation_timecreation_host = "%s"lock_args = "%s"allocation_policy = "%s"profile = "%s"read_ahead = -1# Noneread_ahead = %umajor = %dminor = %dsegment_count = %usegment%u {start_extent = %uextent_count = %ureshape_count = %utype = "%s%s"physical_volumes {device = "%s"device_id_type = "%s"device_id = "%s"dev_size = %lupe_start = %luba_start = %luba_size = %luseqno = %uformat = "%s"# informationalsystem_id = "%s"lock_type = "%s"extent_size = %umax_lv = %umax_pv = %umetadata_copies = %utext pv_namespv%dhistorical_logical_volumes {removal_timeorigin = "%s%s"descendants = %s%ss = ["%s", %u%s"%s", "%s"%sGigabytesTerabytesPetabytesExabytes?@P?Internal error: Unknown flag set requested.Internal error: Metadata inconsistency: Not all flags successfully exported.Cannot duplicate segment string.WARNING: Unrecognised flag %s in segment type %s.format_text/flags.cStatus value is not a string.CACHE_VOLUnknown status flag '%s'.PARTIAL+%sREADWRITEWRITE_LOCKEDFIXED_MINORVISIBLEPVMOVENOTSYNCEDREBUILDRESHAPE_DATA_OFFSETRESHAPE_DELTA_DISKS_PLUSRESHAPE_DELTA_DISKS_MINUSREMOVE_AFTER_RESHAPEWRITEMOSTLYACTIVATION_SKIPNOAUTOACTIVATEERROR_WHEN_FULLMETADATA_FORMATCROP_METADATACACHE_USES_CACHEVOLALLOCATABLEEXPORTEDMISSINGRESIZEABLECLUSTEREDSHAREDformat_text/format-text.cUnlinking %sRenaming %s to %s%s: rename to %s failed: %sTest mode: Skipping renameFailed to read VG %s from %sRead volume group %s from %smda_context allocation failed LVM2 x[5A%r0N*>fdopenWriting %s metadata to %sfsyncpe_startMDA1 startdisk sizeMDA0 endlabel scan sizepe_endba_endPV %s missing from cache%s.tmp(ignored)(used)empty preWrite from %s.Write[%u] from %s.VG %s metadata writing failedFailed to read vg %s from %sVG %s not found on %sWARNING: No cache info for %sFailed to allocate dir_listtext_orphanInitialised format: %sTest mode: Skipping committing %s metadata (%u)Committing file %s metadata (%u)Renaming path %s is too long for VG %s.'%s' does not contain volume group '%s'.PV init requested data_alignment_sectors %llu data_alignment_offset_sectors %lluPV init config data_alignment_sectors %llu%s: pe_align (%llu sectors) must not be less than pe_align_offset (%llu sectors)PV init final alignment %llu sectors from align %llu align_offset %llu%s: Data alignment must not exceed device size.%s: Bootloader area with data-aligned start must not exceed device size.Setting pe start to %llu sectors after ba start %llu size %llu for %sSetting PE start to %llu sectors for %sSetting pe start to requested %llu sectors for %s%s: Bootloader area would overlap data area.Physical extents (%s) end beyond end of device (%s) %s.Reading mda header sector from %s at %lluFailed to read metadata area header on %s at %lluWARNING: wrong checksum %x in mda header on %s at %lluWARNING: wrong magic number in mda header on %s at %lluWARNING: wrong version %u in mda header on %s at %lluWARNING: wrong start sector %llu in mda header on %s at %lluFailed to write mda header to %s.Internal error: can't remove metadata area with index %u from PV %s. Metadata layou not supported by %s format.Text format failed to determine directory.Couldn't create temporary text file name.Failed to write metadata to %s.Creating metadata area on %s at sector %lu size %lu sectorsInternal error: invalid index of value %u used while trying to add metadata area on PV %s. Metadata layout not supported by %s format.Internal error: metadata area with index %u already exists on PV %s and removal failed.Using limited metadata area size on %s with value %lu (limited by %s of %lu).Metadata area size too small: %lu bytes. It must be at least %u bytes.Failed to wipe new metadata area on %s at %llu len %llustruct metadata_area allocation failedstruct mda_context allocation failedNot enough space available for metadata area with index %u on PV %s.Failed to move metadata area with index 1 while resizing PV %s.PV %s too large for extent size %s.Random lvid creation failed for %s/%s.PV %s header needs rewrite for new ext versionPV %s header needs rewrite to set ext usedCouldn't allocate text_fid_context.%s: Volume group filename may not end in .tmpCouldn't allocate text format context object.Couldn't create metadata index for format instance of VG %s.No cached vginfo for VG %s and ID %s.struct mda_header allocation failedWARNING: Removing metadata location on %s with bad mda header.Failed to write metadata area headerVG %s metadata %scommit %sseq %u on %s mda header at %llu %s.VG %s metadata %scommit %sslot0 offset %llu size %llu slot1 offset %llu size %llu.VG %s seqno %u metadata write to %s mda_start %llu mda_size %llu mda_last %lluVG %s %u metadata on %s (%llu bytes) exceeds maximum metadata size (%llu bytes)VG %s %u new metadata start align from %llu to beginning %uVG %s %u new metadata start align from %llu to %llu (+%llu)VG %s %u wrapping metadata new_start %llu new_size %llu to size1 %llu size2 %lluVG %s %u metadata area location old start %llu last %llu size %llu wrap %lluVG %s %u metadata area location new start %llu last %llu size %llu wrap %lluVG %s %u metadata on %s (%llu bytes) too large for circular buffer (%llu bytes with %llu used)VG %s %u metadata disk location start %llu size %llu last %lluVG %s %u metadata disk location write1 start %llu size %llu last %llu write2 start %llu size %llu last %lluVG %s %u metadata last align from %llu to %llu (+%u)VG %s %u %s adjusted metadata end %llu extra %u larger than write buffer %lluVG %s %u metadata last align from %llu to %llu (+%u) (wrapped)VG %s %u %s adjusted metadata end %llu wrap %llu extra %u larger than write buffer %lluVG %s %u %s metadata write size %llu %llu larger than buffer %lluVG %s %u metadata write at %llu size %llu (wrap %llu)VG %s %u metadata write at %llu size %llu (wrapped)Failed to write metadata wrap to %sWARNING: Failed to read metadata text at %llu off %llu size %llu VG %s on %sFound metadata text at %llu off %llu size %llu VG %s on %sWARNING: reading %s mda%d failed to read metadata.WARNING: repair VG metadata on %s with vgck --updatemetadata.Internal error: read_metadata_location_summary called with NULL pointer for mda_headerMetadata location on %s at %llu has offset 0.Skipping read of already known VG metadata with matching mda checksum on %s.WARNING: metadata on %s at %llu has invalid summary for VG.WARNING: metadata on %s at %llu has invalid VG name.Found metadata summary on %s at %llu size %llu for VG %sFailed to allocate text format type structure.Couldn't create text label handler.Couldn't register text label handler.Failed to read outdated pv mda header on %sFailed to write outdated pv mda header on %s LVM2 x[5A%r0N*>format_text/import.cReading metadata summary from %s at %llu size %d (+%d)WARNING: invalid metadata text from %s at %llu.WARNING: invalid metadata text from file.Skipped parsing metadata on %sFailed to allocate VG fmtdata for text format.Reading metadata from %s at %llu size %d (+%d)WARNING: couldn't read volume group metadata from %s.WARNING: couldn't read volume group metadata from file.There are %d physical volumes missing.descriptionCould not find status flags.format_text/import_vsn1.cCould not read status flags.Could not read flags.Couldn't find section '%s'.Importing logical volume %s.creation_hostcontentsmissing contents fieldText Format Volume Groupunrecognised contents fieldmissing version numberunrecognised version numberCouldn't find uuid.Invalid uuid.Empty pv section.dev_sizeEmpty logical volume section.Empty segment section.reshape_countSegment allocation failed_mimagetmpsegment_countmax_lvmax_pvmetadata_copiesphysical_volumeshistorical_logical_volumesread_vgCouldn't read pv summariesUnknown historical logical volume %s/%s%sCouldn't read origin for historical logical volume %s/%s%sCouldn't get descendants list for historical logical volume %s/%s%sFound empty descendants list for historical logical volume %s/%s%sFailed to allocate list item for historical logical volume %s/%s%sUnknown origin %s for historical logical volume %s/%s%sDescendant value for historical logical volume %s/%s%s is not a string.Failed to find descendant %s for historical LV %s.Found an item that is not a stringEmpty logical volume section for %s.Couldn't read status flags for logical volume %s.Invalid creation_time for logical volume %s.Couldn't read creation_host for logical volume %s.Missing creation_time for logical volume %s.WARNING: Ignoring unrecognised allocation policy %s for LV %s.Adding profile configuration %s for LV %s.Failed to add configuration profile %s for LV %s.Couldn't read tags for logical volume %s.Couldn't use another pool metadata spare logical volume %s.Logical volume %s is pool metadata spare.Logical volume %s is sanlock lv.Can't process text format file - %s.Couldn't read uuid for physical volume.Couldn't read status flags for physical volume.Couldn't read dev size for physical volume.Failed to allocate memory for device hint in read_pv.Failed to allocate memory for device_id in read_pv.Failed to allocate memory for device_id_type in read_pv.Couldn't read extent start value (pe_start) for physical volume.Couldn't find extent count (pe_count) for physical volume.Found bootloader area specification for PV %s in metadata: ba_start=%lu, ba_size=%lu.Found incomplete bootloader area specification for PV %s in metadata.Couldn't read tags for physical volume %s in %s.Lost logical volume reference %sCouldn't read uuid for logical volume %s.Couldn't read 'start_extent' for segment '%s' of logical volume %s.Couldn't read 'extent_count' for segment '%s' of logical volume %s.Segment type must be a string.Cannot duplicate segtype string.Couldn't read segtype for logical volume %s.Couldn't read tags for a segment of %s/%s.Only one segment permitted for snapshotCouldn't read segment count for logical volume %s.segment_count and actual number of segments disagree for logical volume %s.Couldn't read minor number for logical volume %s.WARNING: Couldn't read major number for logical volume %s.WARNING: Ignoring invalid major, minor number for logical volume %s.Couldn't create pv hash table.Couldn't create lv hash table.Unrecognised format %s for volume group %s.Couldn't read uuid for volume group %s.Couldn't read 'seqno' for volume group %s.Error reading flags of volume group %s.Failed to allocate memory for system_id in _read_vg.Couldn't read extent size for volume group %s.Couldn't read 'max_lv' for volume group %s.Couldn't read 'max_pv' for volume group %s.WARNING: Ignoring unrecognised allocation policy %s for VG %sAdding profile configuration %s for VG %s.Failed to add configuration profile %s for VG %sCouldn't find all physical volumes for volume group %s.Couldn't read tags for volume group %s.Couldn't read all logical volume names for volume group %s.Couldn't read all historical logical volumes for volume group %s.Couldn't read all logical volumes for volume group %s.Couldn't read all removed logical volume interconnections for volume group %s.Failed to fixup mirror pointers after import for volume group %s.Couldn't find volume group in file.Empty removed logical volume section.Couldn't read uuid for removed logical volume %s in vg %s.Invalid creation_time for removed logical volume %s.Invalid removal_time for removed logical volume %s.Removed logical volume structure allocation failedCouldn't find status flags for volume group %s.Couldn't read seqno for volume group %s.Failed to allocate memory for device hint in read_pv_sum.Failed to allocate memory for device_id in read_pv_sum.Failed to allocate memory for device_id_type in read_pv_sum.Bad volume name in areas array for segment %s.Missing offset in areas array for segment %s.Bad offset in areas array for segment %s.Zero areas not allowed for segment %sCouldn't find volume '%s' for segment '%s'.Incorrect number of areas in area array for segment '%s'.s, mda2 ( mda1 ( da1 (format_text/text_label.c ba1 (Retrying metadata scan.Scanning %s found no mdas.Scanning %s mda1 summary.Scanning %s mda2 summary.Internal error: %s label header currently requires a data area.%s: Preparing PV label header %s size %lu with%s%.*lu%s%.*lu%s%s%.*lu%s%.*lu%s%s%.*lu%s%.*lu%s%s%.*lu%s%.*lu%sWARNING: bad metadata header on %s at %llu.Ignoring mda on device %s at offset %luWARNING: bad metadata text on %s in mda%dFound pv_header_extension version %u on %sWARNING: Scanning %s mda1 found mismatch with other metadata.WARNING: Scanning %s mda1 failed to save internal summary.Found metadata seqno %u in mda1 on %sWARNING: Scanning %s mda2 found mismatch with other metadata.WARNING: Scanning %s mda2 failed to save internal summary.Found metadata seqno %u in mda2 on %sWARNING: scanning %s mda2 failed to read metadata summary.WARNING: scanning %s mda1 failed to read metadata summary.struct data_area_list allocation failedstruct mda_list allocation failedCouldn't allocate labeller object.freeseg/freeseg.cFailed to set up async io, using sync io.Failed to set up io layer with %d blocks.scan_dev_close %s no DEV_IN_BCACHE setscan_dev_close %s already closedDevice open %s has DEV_IN_BCACHE already setDevice open %s already open with di %d fd %dDevice open %d:%d has no path names.Can't open %s exclusively. Mounted filesystem?Drop alias for %d:%d failed open %s (%d)Invalid path %s for device %d:%d, trying different path.Scanning %d devices for VG infoProcessing data from device %s %d:%d di %dClear pvid and info for filtered dev %sIgnoring additional label on %s at sector %llu%s: Label for sector %llu found at sector %llu - ignoring.Label checksum incorrect on %s - ignoringFound label at sector %llu on %sClear pvid and info for no lvm header %slabel scan found duplicate PVID %s on %sWARNING: scan failed to get metadata summary from %s PVID %sScanned devices: read errors %d process errors %d failed %dCouldn't allocate memory for labeller list object.Checking fd limit for num_devs %u failed %dChecking fd limit for num_devs %u want %u soft %lld hard %lldSetting fd limit for num_devs %u soft %lld hard %lldWARNING: permission error setting open file limit for scanning %u devices.WARNING: cannot set open file limit for scanning %u devices.Enable full md component check.Filtering devices to scan (nodata)Will scan %d remaining devicesWARNING: metadata may not be usable with current io_memory_size %d KiBWARNING: increase lvm.conf io_memory_size to at least %llu KiBCannot reopen rw device %d:%d with no valid paths di %d fd %d.Cannot reopen rw device %d:%d with no valid name di %d fd %d.Reopen writeable %s uncached fd %d di %dFailed to open writable %s index %d fd noneFailed to open writeable %s index none fd %dFailed to open rw %s errno %d di %d fd %d.Failed to change to rw fd %s di %d fd %d.reopen writeable %s close prev errno %d di %d fd %d.reopen writable %s di %d prev %d fd %dError opening device %s for reading at %llu length %u.Error reading device %s at %llu length %u.Scanning failed to get devices.Set last byte mixed block sizes physical %u logical %u using 512Set last byte mixed block sizes physical %u logical %u using 4096dev_write bcache not set up %sError opening device %s for writing at %llu length %u.Error writing device %s at %llu length %u.Label handler does not support label writesLabel sector %lu beyond range (%ld)%s: Writing label to sector %lu with stored offset %u.dev_set_bytes bcache not set up %sError writing device value %s at %llu length %u.Scanning for labels to wipe from %sFailed to read label from %s sector %llu%s: Wiping label at sector %lluFailed to remove label from %s at sector %llulabel/label.cFailed to set up sync io.close %s errno %drwexrwFailed to set bcache fd.open %s %s di %d fd %dScan failed to open %d:%d %s.Scanning submitted %d readsScan failed to read %s.%s: No lvm label detectedScan failed to process %slabel allocaction failedFinding devices to scanFailed to set up devices.Failed to get device list.close and reopen excl %sclose and reopen rw %sdev_read bcache not set up %sFiltering devices to scanReading labels for pvidclose and reopen to write %sFailed to open device %sFailed to write label to %s/run/lvm/hintslabel/hints.cunlock_hints no existing fdunlock_hints flock errno %dlock_hints existing fd %dlock_hints open errno %d %slock_hints close errno %d %s/run/lvm/newhintsnewhints created/run/lvm/nohintstouch_hints errno %d %stouch_hints close errno %d %sunlink_nohints errno %d %sclear_hints open errno %dunlink_hints errno %d %sclear_hints flush errno %d %sclear_hints close errno %d %sReading hint filehints_version:%d.%dglobal_filter:scan_lvs:devices_file:devs_hash:scan:pvid:devn:%d:%dadd hint %s %s %d:%d %saccept hints found %dread_hint_file close errno %dWriting hint file %d# info: duplicate_pvs # info: duplicate_vgnames # Created by %s pid %d %shints_version: %d.%d global_filter:%s scan_lvs:%d devices_file:%s devices_file:. devs_hash: %u %u unlink_newhints errno %d %sclear_hint_filepvscan_recreate_hints_beginget_hints: pvscan recreateget_hints: nohints filenohints_exist errno %d %snewhints_exist errno %d %sget_hints: newhints fileget_hints: no fileget_hints: lock failget_hints: read failget_hints: needs refreshget_hints: no entries# Created empty by %s pid %d %signore hints with unknown version %d.%dignore hints with version %d.%d current %d.%dignore hints with different global_filterignore hints with different filterignore hints with different or unreadable scan_lvsignore hints with different devices_file: not enabled vs %signore hints with different devices_file: %s vs %signore hints with invalid devs_hashignore hints with read_hash %u count %u calc_hash %u count %uHints not used with duplicate pvsHints not used with duplicate vg namesUncertain hint for unread device %d:%d %sInvalid hint device %d:%d %s pvid %s had hint pvid %sInvalid hint device %d:%d %s pvid %s had vgname %s no VG info.Invalid hint device %d:%d %s pvid %s had vgname %s no PV info.skip hint hash but found label %sexclude md component from hints %sscan:%s pvid:%s devn:%d:%d vg:%s Wrote hint file with devs_hash %u count %uwrite_hint_file close errno %dget_hints: applied using %d other %d vgname %s#global%s/P_%slocking/file_locking.c%s/V_%sToo long locking filename %s/P_%s.Too long locking filename %s/V_%s.Path for locking_dir %s is invalid.locking/locking.cglobal flock already held exFailed to activate %sLVM_SUPPRESS_LOCKING_FAILURE_MESSAGESFile locking initialisation failed.File locking settings: readonly:%d sysinit:%d ignorelockingfailure:%d global/metadata_read_only:%d global/wait_for_locks:%d.Internal error: Resource name %s is too long.Operation prohibited while --readonly is set.Allowing activation with --readonly --sysinit.Operation prohibited while global/metadata_read_only is set.Internal error: Unknown locking mode %s.%H:%M:%S.%06ld LVM_SUPPRESS_SYSLOGfailed to write log file: %s failed to write log file DM_ABORT_ON_INTERNAL_ERRORSInternal error: failed to report cmdstatusCODE_LINE=650CODE_FILE=log/log.c%s%s %s:%d%s%s %s:%d%s%s%s %sstderrdup2dup2(%d, %d) returned %dLVM_LOG_FILE_EPOCH%s_%s_%d_%lluLVM_LOG_FILE_MAX_LINESLVM_EXPECTED_EXIT_STATUSMESSAGE=lvm command %sCODE_LINE=882PRIORITY=%iLVM_CMD_ID=%sLVM_CMD_NAME=%sfatalnoticecmdlabelprocessingvsnprintf failed: skipping external logging function %s:%d %sAborting. Command has reached limit for logged lines (LVM_LOG_FILE_MAX_LINES=%lu).File descriptor %d already open in read-only mode, expected write-only or read-write mode.Can't set standard input for log output.Failed to open stream for file descriptor %d.Failed to allocate buffer for stream on file descriptor %d.Internal error: reopen_standard_stream called on non-standard streamWARNING: Ignoring invalid LVM_LOG_FILE_EPOCH envvar "%s".%d %*s %*c %*d %*d %*d %*d %*d %*u %*u %*u %*u %*u %*u %*u %*d %*d %*d %*d %*d %*d %lluWARNING: Cannot parse content of %s.WARNING: Debug log file path is too long for epoch.WARNING: Ignoring invalid LVM_LOG_MAX_LINES envvar "%s".MESSAGE_ID=3ca432788c374e4ba684b834188eca36Ignoring unrecognized journal value.log_command_vprint_log/proc/self/statsmqmetadata/cache_manip.cUnknown cache mode: %s.another LVCan't convert internal LV %s.Setting chunk size to %s.%s_cpoolFlushing of %s aborted.Use cache metadata format 2.WARNING: Cannot detect default cache policy, using "mq".Default cache policy is not available.Detected default cache_policy "%s".Internal error: Cache pool %s has undefined cache mode, using writethrough instead.Internal error: Cache mode is not determined.Internal error: Cannot set cache mode for non cache volume %s.WARNING: Data redundancy could be lost with writeback caching of raid logical volume!Cannot use chunk size %s with cache pool %s metadata size %s.Minimal size for cache pool %s metadata with chunk size %s would be %s.Cannot use too small chunk size %s with cache pool %s data volume size %s.Maximum configured chunks for a cache pool is %lu.Use smaller cache pool (<%s) or bigger cache chunk size (>=%s) or enable higher values in 'allocation/cache_pool_max_chunks'.Cannot use locked cache pool %s.Logical volume %s is already in use by %s.Cannot use locked origin volume %s.Cache is not supported with %s segment type of the original logical volume %s.Cache chunk size %s is not in the range %s to %s.Cache chunk size %s must be a multiple of %s.Using %s chunk size instead of default %s, so cache pool has less than %lu chunks.Chunk size %s is less than required minimal chunk size %s for a cache pool of %s size and limit %lu chunks.To allow use of more chunks, see setting allocation/cache_pool_max_chunks.Size of %s data volume cannot be smaller than chunk size %s.Preferred pool metadata size %s.Can't prepare new cachepool name for %s.WARNING: Skippping flush for failed cache %s.Flushing %lu blocks for cache %s.WARNING: Dirty blocks found on read-only cache volume %s.Failed to sync local devices when clearing cache volume %s.Failed to sync local devices after final clearing of cache %s.Internal error: LV %s is not cache volume.Internal error: LV %s is already dropped cache volume.Failed to activate %s to flush cache.Internal error: Cannot set cache metadata format for non cache volume %s.Failed to duplicate policy name.WARNING: Cannot detect default cache metadata format, using format: %u.Cache metadata format %u is not supported by kernel target.Detected default cache metadata format: %u.Internal error: Extend size can't be 0.The minimum cache size is two extents (%s bytes).Rounding down metadata size to max size %sRounding up metadata size to min size %sRounding up metadata size to full physical extent %sCache data blocks %llu and chunk size %u exceed max chunks %llu.Use smaller cache, larger --chunksize or increase max chunks setting.Internal error: Missing cache policy name.Setting LV %s cache on %s meta start 0 len %llu data start %llu len %llu sectorsSetting LV %s cache format %u policy %s chunk_size %u sectorsWARNING: thin pool data will not be automatically extended when cached.WARNING: manual splitcache is required before extending thin pool data.Replacing chunk size %s in cache pool %s with chunk size %s from profile.Internal error: Failed to wipe cache pool for volume %s.Aborting. Failed to activate cache pool %s.Aborting. Failed to wipe cache pool %s.Aborting. Could not deactivate cache pool %s.%s=%smetadata/writecache_manip.c%s=%llureporter_poollvol%dflush_on_suspendRemoving previous wcorig %sFailed to deactivate %s.Failed to update VG.Failed to get mem for LV status.Failed to get device mapper status for %sNo device mapper info exists for %sInvalid device mapper status type (%d) for %sLV %s has no suffix for cachevol (skipping rename).Failed to generate new unique name for unused LV %sLV %s segment is not writecache.LV %s writecache segment has no writecache.LV %s writecache segment has no originFailed to set flush_on_suspend in writecache detach %s.Failed to remove seg in writecache detach.Failed to remove lv layer in writecache detach.Failed to write VG in writecache detach.Failed to get lv_committed in writecache detach.Suspending writecache to detach %sFailed to suspend LV in writecache detach.Checking writecache errors to detach.Failed to get writecache error status for %s.Failed to flush writecache (error %u) for %s.Failed to commit VG in writecache detach.Resuming after writecache detached %sFailed to resume LV in writecache detach.Deactivating previous cachevol %sFailed to deactivate previous cachevol in writecache detach.Deactivating previous wcorig %sFailed to deactivate previous wcorig LV in writecache detach.Failed to remove previous wcorig LV in writecache detach.Failed to write and commit VG in writecache detach.Failed to activate LV %s for flushing writecache.Failed to sync local devices before detaching writecache.Failed to flush writecache for %s.Failed to deactivate LV %s for detaching writecache.Failed to set writecache cleaner for %s.Failed to create list of writecache settings.metadata/integrity_manip.cbitmapJ%s_imetalvconvertcrc32cLV update and reload failedFailed to add integrity.lvcreateLV %s segment has no integrity metadata device.LV %s integrity segment has no originextend not needed for imeta LV %sFailed to build list of PVs for extending %s.Failed to extend integrity metadata LV %sLV %s segment is unsupported raid for integrity.Failed to update and reload LV after integrity remove.Failed to deactivate unused iorig LV %s.Failed to deactivate unused imeta LV %s.Failed to remove unused iorig LV %s.Failed to remove unused imeta LV %s.Invalid raid integrity mode (use "bitmap" or "journal")Integrity can only be added to top level raid LV.Integrity cannot be added to snapshot origins.Integrity can only be added to raid1,4,5,6,10.raid image must be linear to add integrityFailed to build list of PVs for %s.Failed to create metadata LV name.Creating integrity metadata LV %s with size %s.Failed to create integrity metadata LVIntegrity metadata uses more than one segment.Failed to activate LV %s to zeroFailed to zero LV for integrity metadata %sFailed to deactivate LV %s after zeroFailed to activate LV to check block size %sIntegrity requires consistent logical block size for LV devices.Invalid integrity block size, possible values are 512, 1024, 2048, 4096Integrity block size %u not allowed with device logical block size 4096.Using integrity block size %u with unknown device logical block size.Path name too long to get LV block size %sCannot use integrity block size %u with unknown file system block size, logical block size %u, physical block size %u.Using integrity block size %u for unknown file system block size, logical block size %u, physical block size %u.Limiting integrity block size to 512 because the LV is active.Using integrity block size %u for file system block size %u.Integrity block size %u cannot be larger than file system block size %u.Failed to deactivate LV after checking block size %sAdding integrity to raid image %sWriting VG and updating LV with new integrity LV %sWriting VG with new integrity LV %sActivating to start integrity initialization for LV %sFailed to activate integrity LV to initialize.Writing VG with initialized integrity LV %sNew integrity metadata LV may require manual removal.Invalid LV type for clearing integrityWARNING: failed to clear integrity recalculate flag for %sunassignedmetadata/lv.c:%u-%u(%u)nopassdownnot monitored%s is %son %slvfullname snprintf faileddm_pool_alloc failedlvpath snprintf faileddm_build_dm_name failedlv_dmpath snprintf failed%s/%s%sreshapeFailed to duplicate hostnameActivating logical volume %s.Thin volume %s is active._format_pvsegs: str_list_create failedInternal error: Unknown area segtype._format_pvseggs: extent range dm_snprintf failed_format_pvsegs: extent number dm_snprintf failed_format_pvsegs: list item dm_pool_zalloc failed_format_pvsegs: list item dmsnprintf failed_format_pvsegs: failed to add item to listInternal error: Bad pvmove structureCannot query non thin-pool segment of LV %s for discards property.Kernel reports unknown discards status %u.lvseg_kernel_discards_dup_with_info_and_seg_status: dm_pool_strdup failed.WARNING: Thin volume %s maps %s while the size is only %s.Internal error: for_each_sub_lv failure.modules str_list allocation failedInternal error: Cannot find mirror segment.Internal error: %s is not a RAID imageFailed to find RAID segment for %s%s on %s is not a RAID segmentInternal error: sub-LV %s was not found in raid segmentInternal error: %s is not of RAID typeInternal error: %s on %s is not a RAID segment.Failed to lock logical volume %s.Deactivating logical volume %s.Failed to unlock logical volume %s. USTT TTTUSFailed to allocate memorymetadata/lv_manip.c %s/%s uses %shistorical Failed to create new nameCannot rename locked LV %s--dry-run--verbose--yes--force merging origin clustered and DISCARD with %u snapshots(s) with snapshot %s (origin only)ConsideringChanging with PV tags: pv_list allocation failedraid0raid4raid5raid5_laraid5_raraid5_lsraid5_rsraid6raid6_zrraid6_nrraid6_ncmultithinoriginthinsnapshotmultiextthinoriginwritecacheoriginintegrityoriginmultithickoriginthicksnapshotpublicStack %s:%u[%u] on LV %s:%u.Internal error: Meta le != 0.Failed to suspend %s.Failed to reactivate %s.metadata areaup to contiguous dm_pool_begin_object faileddm_pool_grow_object failedCling_to_allocated is %sset %u %s%s of %u extents eachSorting %u log areasSorting %u areasphysicallogicalat most Extending %u mirror images.Using default stripesize %sNew size of 0 not permitted.Invalid stripe size %s.Can't resize reshaping LV %s.Live by historical LVCreating logical volume %sLV %s in VG %s is now hidden.Historical lFailed to remove cachevol %s.Failed to deactivate LV %sFailed to update pool %s.Removing snapshot volume %s.lvremovevgremovePostponing write and commit.WARNING: Failed to unlock %s.cache originexternal originVDO poolHistorical Layer segment found: %s:%uLayer is not linear: %s:%uMissing error segtypelv_list alloc failedCan't move snapshot segment.Removing layer %s for %sFailed to find layer %s in %s_mimageCreation of layer LV failedInserting layer %s for %s_mimage_0Inserting %s:%u-%u of %s/%sInterrupted initialization ofFailed to wipe signatures onFailed to initializeInterrupted initialization%s logical volume %s.BLKZEROOUTioctlNo meta_areas for RAID typeFailed to extend %s in %s.Failed to remove LVFailed to commit VG %srimage%s_%s_%u%s_%s%s_rmeta_%uFailed to insert layer for %sReducExtend and openlv_info failed: aborting.Filesystem check failed.Filesystem resize failed.Failed to activate %s.%s: discarding failed.Problem deactivating %s.snapshot exception storestart of new LVAdding integrity to new LVCache pool is prepared.Failed to activate thin %s.Failed to activate new LV %s.Aborting. Failed to wipe %s.%s_voriginCouldn't create snapshot.vpool%dthin-poolvdo-poolLogical volume "%s" created.Cannot rename "%s": name format not recognized for internal LV "%s"Failed to allocate space for new nameCannot rename "%s". New logical volume name "%s" is invalid.%sLogical Volume "%s" already exists in volume group "%s"Couldn't create LV path for %s.Couldn't generate new LV size string.Do you really want to remove%s%s%s%s logical volume %s%s? [y/n]: Logical volume %s not removed.Updating logical volume %s on disk(s)%s.Dropping origin_only for %s as lock holds %sFailed to suspend logical volume %s.Failed to revert logical volume %s.Updating logical volume %s in kernel.Problem reactivating logical volume %s.Rounding size %s (%u extents) %s to stripe boundary size %s (%u extents).WARNING: Ignoring invalid string in config file entry allocation/cling_tag_listWARNING: Ignoring empty string in config file entry allocation/cling_tag_listWARNING: Ignoring string not starting with @ in config file entry allocation/cling_tag_list: %sWARNING: Ignoring empty tag in config file entry allocation/cling_tag_listPV tags string extension failed.Not using free space on %s: Matched allocation PV tag %s on existing parallel PV %s.Matched allocation PV tag %s on existing %s with free space on %s.Eliminating allocation area %u at PV %s start PE %u from consideration: PV tag %s already used.Memory reallocation for parallel areas failed.PV tags string allocation failed.%s allocation area %u %s %s start PE %u length %u leaving %u%s%s.WARNING: Read-only activated logical volume %s not zeroed.WARNING: Logical volume %s not zeroed.Signature wiping on logical volume %s not requested.Failed to find segment for %s extent %uLV layout list allocation failedLV role list allocation failedInternal error: WARNING: Failed to properly detect layout and role for LV %s/%s.Overriding default 'mirror_region_size' setting with 'raid_region_size' setting of %u kiBReducing region size to %u kiB (power of 2).Using default region size %u kiB (multiple of page size).Adding %s:%u as an user of %s.Failed to allocate segment list.%s:%u is no longer a user of %s.Internal error: Segment %s:%u is not a user of %s.Internal error: get_only_segment_using_this_lv() called with NULL LV.%s is expected to have only one segment using it, while %s:%u uses it %d times.%s is expected to have only one segment using it, while it has %d.Internal error: alloc_lv_segment: Missing segtype.Internal error: Try to set to high area number (%u >= %u) for LV %s.Failed to allocate widened LV segment for %s.Refusing refresh of partial LV %s. Use '--activationmode partial' to override.Couldn't allocate new %s segment.allocate_extents does not handle virtual segmentsInternal error: Missing allocatable pvs.Metadata format (%s) does not support required LV segment type (%s).Consider changing the metadata format by running vgconvert.Internal error: _alloc_init called for virtual segment.Internal error: _alloc_init called for non-virtual segment with no disk space.allocation pool creation failedallocation handle allocation failedInternal error: Bad metadata_area_countLog size needs too many extents %lu with region size of %u sectors.Adjusted allocation request to %u logical extents. Existing size %u. New size %u.Mirror log of %u extents of size %u sectors needed for region size %s._allocate called with no work to do!Number of extents requested (%u) needs to be divisible by %u.Parallel PVs at LE %u length %u: %sNot enough PVs with free space available for parallel allocation.Consider --alloc anywhere if desperate.Couldn't allocate areas array.Trying allocation using %s policy.Insufficient free space: %lu extents needed, but only %u available%u preferred area(s) to be filled positionally.Areas to be sorted and filled sequentially.Still need %s%u total extents from %u remaining (%u positional slots): %u (%u data/%u parity) parallel areas of %u extents eachFound %u areas for %u parallel areas and %u log areas so far.Filled %u out of %u preferred areas so far.Not using free space on existing parallel PV %s.Internal error: _alloc_parallel_area called without any allocation to do.alloced_area allocation failedMetadata does not fit on a single PV.Allocating parallel metadata area %u on %s start PE %u length %u.Allocating parallel area %u on %s start PE %u length %u.Insufficient suitable %sallocatable extents for logical volume %s: %u more requiredInsufficient suitable %sallocatable extents found for logical volume %s.Found fewer %sallocatable extents for logical volume %s than requested: using %u extents (reduced by %u).Insufficient free space for log allocation for logical volume %s.Missing segtype in lv_add_segment().lv_add_segment cannot handle virtual segmentsLog segments can only be added to an empty LVCouldn't allocate new LV segment.Couldn't merge segments after extending logical volume.Generating list of PVs that %s/%s uses:Rounding size to boundary between physical extents: %s.Reducing %u%%VG to remaining free space %s in VG.Specified LV does not have an origin LV.Internal error: Unsupported percent type %u.Converted %u%%%s into %s%u %s extents.VolumeType does not match (%s).Logical volume %s is using mixing segment types %s and %s.Cannot vary number of mirrors in LV yet.Internal error: Missing mirror segments for %s.Please specify number of stripes (-i) and stripesize (-I)Unable to extend "%s" segment type with different number of stripes.Using stripesize of last segment %sStripesize for striped segment should not be 0!Increasing incremention size from %s to %s to fit new VDO slab.Unable to extend %s by %u logical extents: exceeds limit (%u).Reached maximum COW size %s (%u extents).Reached maximum pool metadata size %s (%u extents).Thin pool will use metadata without cropping.Ignoring stripes, stripesize and mirrors arguments when reducing.Unable to reduce %s below 1 extent.New size (%d extents) matches existing size (%d extents).Rounding size (%d extents) up to stripe boundary size for segment (%d extents).Rounding size (%d extents) down to stripe boundary size for segment (%d extents)New size given (%d extents) not larger than existing size (%d extents)New size given (%d extents) not less than existing size (%d extents)New size (%d extents) matches existing size (%d extents)New size for %s: %u. Existing logical extents: %u / physical extents: %u.Snapshot origin volumes cannot be reduced in size yet.Snapshot origin volumes can be resized only while inactive: try lvchange -an.Thin pool volumes %s cannot be reduced in size yet.Thin pool metadata volumes cannot be reduced.Cannot reduce VDO pool data volume %s.Reduce not yet allowed on LVs with writecache attached.Support for online metadata resize of %s not detected.Thin target does not support external origin smaller then thin volume.Failed to allocate generic logical volume structure.Failed to allocate generic logical volume list item.Failed to allocate generic volume list item for indirect glv %sInternal error: %s logical volume %s is not a user of %s.Internal error: historical_glv_remove: historical LV %s/-%s not found Historical LV %s/-%s already on removed list Removing historical connection between %s and %s.Unable to allocate logical volume structureFailed to generate unique name for the new logical volumeUnable to create LV %s in Volume Group %s: name already in use%s.parallel_areas allocation failedLV %s in VG %s is now visible.Dropping snapshot merge of %s to removed origin %s.Dropping snapshot merge of removed %s to origin %s.Internal error: Pool size mismatched data size for %sSegment extent reduction %u not divisible by #stripes %uUnable to deactivate spare logical volume %s.Internal error: Removing still active LV %s.Can't remove logical volume %s under snapshot.Can't remove external origin logical volume %s.Can't remove logical volume %s used by a mirror.Can't remove logical volume %s used as mirror log.Can't remove logical volume %s used as RAID device.Can't remove logical volume %s used by a pool.Internal error: Thin LV %s without pool.Can't remove locked logical volume %s.Failed to detach writecache from %sIgnoring update failure of pool %s.Error releasing logical volume %s with pending delete.Unable to deactivate logical volume %s.Detach cachevol before removing.Releasing %slogical volume "%s"Error releasing %slogical volume "%s"%sogical volume "%s" successfully removed.Failed to obtain merging snapshot progress percentage for logical volume %s.Can't remove merging snapshot logical volume %s.Removing snapshot %s that failed to merge may leave origin %s inconsistent. Proceed? [y/n]: Removing origin logical volume %s with %u snapshots(s).Removing merging origin logical volume %s.Unable to remove %s, volume is merged to %s.Unable to fully deactivate unused cache-pool %s.Removal of pool metadata spare logical volume %s disables automatic recovery attempts after damage to a thin or cache pool. Proceed? [y/n]: Removing %s %s will remove %u dependent volume(s). Proceed? [y/n]: Remove %s:%u[%u] from the top of LV %s:%u.Failed to unlock vdo pool in lvmlockd.Can't convert non-striped segment to mirrored.Can't convert striped segment with multiple areas to mirrored.Couldn't allocate converted LV segment.Internal error: Mirror layer must be inserted before adding mirrors.Conflicting region_size %u != %u.Failed to find segment for %s extent %u.Failed to split segment at %s extent %u.Cannot rename internal LV "%s".Cannot rename active VDOPOOL volume %s, VDO target feature support is missing.Failed to allocate space for new name.Failed to generate unique name for unused logical volume.Incompatible layer boundary: %s:%u[%u] on %s:%u.layer segment for %s:%u not found.Removing layer %s for segments of %sLayer status does not match: %s:%u status: 0x%lx/0x%lxLayer boundary mismatch: %s:%u-%u on %s:%u / %u-%u / Internal error: Wrong layer %s in %sInvalid %d segments in %s, expected only 1.Invalid %d area count(s) in %s, expected only 1.Invalid seg_type %d in %s, expected LV.Layer doesn't match segment in %s.Inconsistent extent count (%u != %u) of layer %s.Layered name is too long. Please use shorter LV name.Creating transient LV %s for mirror conversion in VG %s.Creation of transient LV %s for mirror conversion in VG %s failed.Aborting. Unable to tag transient mirror layer.Failed to write intermediate VG %s metadata for mirror conversion.Failed to commit intermediate VG %s metadata for mirror conversion.Failed to resume transient LV %s for mirror conversion in VG %s.Internal error: Non-pvmove LV, %s, passed as argument.Internal error: Bad segment type for first segment area.Failed to build pvmove LV-type mirror %s.Inserting layer %s for segments of %s on %sMatched PE range %s:%u-%u against %s %u len %uFailed to insert segment in layer LV %s under %s:%u-%uVolume %s is not active locally (volume_list activation filter?).Failed to sync local devices before wiping volume %s.Name too long - device not cleared (%s)%s: not found: device not clearedFailed to open %s for wiping and zeroing.Wiping known signatures on logical volume %s.Metadata logical volume %s will be fully zeroed.Initializing %s of logical volume %s with value %d.%s logical volume %s at position %lu and size %lu.%s logical volume %s with value %d and size %s.Metadata logical volume %s not fully zeroed and may contain stale data.Internal error: Empty list of LVs given for wiping.Internal error: LVs must be set visible before wiping.Failed to activate localy %s for wiping.Failed to sync local device names after deactivation of wiped volumes.Aborting. Failed to extend %s in %s.Failed to copy tags onto LV %s to clear metadata.Test mode: Skipping wiping of metadata areas.Adding segment of type %s to LV %s.Internal error: Non-empty LV passed to _lv_insert_empty_sublvFailed to create mapping segment for %s.Failed to create sub LV name for LV %s.Insufficient suitable allocatable extents for logical volume %sUnable to read sync percent while LV %s is not locally active.Do full resync of extended portion of %s? [y/n]: Failed to get sync percent for %s.Skipping initial resync for extended portion of %sLV %s cannot be extended while it is recovering.%sing logical volume %s to %s%sSize of logical volume %s unchanged from %s (%u extents).Size of logical volume %s changed from %s (%u extents) to %s (%u extents).Policy-based resize is supported only for snapshot, thin pool and vdo pool volumes.WARNING: Thin pool autoextend threshold %d%% is set below minimum supported 50%%.WARNING: VDO pool autoextend threshold %d%% is set below minimum supported 50%%.WARNING: Snapshot autoextend threshold %d%% is set bellow minimal supported value 50%%.Can't extend %s with %s autoextend percent set to 0%%.Can't read state of locally inactive LV %s.--poolmetadatasize can be used only with thin pools.--poolmetadatasize for thin-pool metadata cannot be used with size.Internal error: No single component user of logical volume %s.Cannot resize inactive VDO logical volume %s.Cannot resize inactive VDO POOL volume %s.Cannot resize external origin logical volume %s.Cannot resize a RAID %s directlyCannot resize logical volume %s while it is tracking a split image.Cannot resize %s LV %s. Convert to more stripes first.RAID module does not support shrinking.Can't resize internal logical volume %s.Can't resize locked logical volume %s.Can't resize logical volume %s while lvconvert in progress.Varied stripesize not supported. Ignoring.Stripe size cannot be larger than %s.Reducing stripe size %s to maximum, physical extent size %s.Stripe size must be power of 2.Ignoring --resizefs as volume %s does not have a filesystem.Varied striping not supported. Ignoring.Mirrors not supported. Ignoring.Cannot resize logical volume %s with active component LV(s).Cannot reduce LV with integrity.Also going to resize thin-pool metadata to match bigger data.Ignoring PVs on command line when reducing.Logical volume %s must be activated before resizing filesystem.Logical volume %s must be activated before reducing device size.WARNING: Reducing active%s logical volume to %s.THIS MAY DESTROY YOUR DATA (filesystem etc.)Do you really want to reduce %s? [y/n]: Logical volume %s NOT reduced.Cannot resize %s without using device-mapper kernel driver.Name too long - device not discarded (%s)%s: not found: device not discarded.%s: max bytes and granularity query fails.WARNING: %s: Discarding %s at offset %lu, please wait...Logical volume %s successfully resized.Failed to sync local devices before deactivating LV %s.ACTIVATION_SKIP flag set for LV %s/%s, skipping activation.Maximum number of logical volumes (%u) reached in volume group %sMetadata does not support %s segments.Volume group %s does not support tags.Metadata only supports readahead values between 2 and 120.Stripe size may not exceed %s.Can't create %s without using device-mapper kernel driver.WARNING: Skipping zeroing and wipping, compiled without activation support.The extent size in volume group %s is too small to support striped RAID volumes.Reducing requested stripe size %s to maximum, physical extent size %s.Internal error: Unable to create new logical volume with no extents.Unable to create %s smaller than 1 chunk.Number of stripes (%u) must not exceed number of physical volumes (%d)Internal error: Cannot create %s volume without %s pool.Couldn't find volume %s in Volume group %s.Cannot use locked pool volume %s.Rounding size (%d extents) up to chunk boundary size (%d extents).Aborting. Failed to locally activate thin pool %s.Cannot create new thin volume, free space in thin pool %s reached threshold.Origin volume %s not found in Volume group %s.Caching of origin cache volume smaller then chunk size is unsupported.Internal error: Pool LV for cache is missing.Logical volume %s is not a cache pool.WARNING: New %s won't be synchronised. Don't read what you didn't write!Logical volume %s is not a thin pool.Snapshots of locked devices are not supported.Cannot use writable LV as the external origin.Cannot use active LV for the external origin.Couldn't find origin volume '%s'.Can't share virtual origins. Use --virtualsize.Virtual size matching available free logical size in VDO pool.Volume group "%s" has insufficient free space (%u extents): %u required.Setting read ahead sectors %u.Setting device number to (%d, %d).Test mode: Skipping activation, zeroing and signature wiping.Aborting. Failed to activate LV %s.Aborting. Failed to activate LV %s locally exclusively.Failed to suspend thin snapshot origin %s.Aborting. Failed to read transaction_id from thin pool %s.WARNING: Metadata for thin pool %s have transaction_id %lu, but active pool has %lu.Restoring previous transaction_id %lu for thin pool %s.Failed to activate thin pool %s.Cannot activate thin pool %s, perhaps skipped in lvm.conf volume_list?Failed to deactivate thin pool %s.Aborting. Failed to activate snapshot exception store.Aborting. Failed to activate temporary volume for VDO pool creation.Aborting. Couldn't deactivate VDO LV %s with skipped activation.Aborting. Leaving cache pool %s and uncached origin volume %s.Reverting created caching layer.LV %s has no suffix for cachepool (skipping rename).Aborting. Couldn't deactivate snapshot COW area %s.Failed to sync local devices before creating snapshot using %s.Zero segment type for virtual origin not foundVirtual origin name is too long.Failed to activate sparce volume %s.Aborting. Manual intervention required.Failed to sync local devices before reverting %s.Unable to deactivate failed new LV %s. Manual intervention required.Manual intervention may be required to remove abandoned LV(s) before retrying.Failed to resume thin snapshot origin %s.Internal error: Unsupported creation of cache and cache pool volume.Internal error: Logical volume is not cache %s.Logical volume %s is now cached.Internal error: Creation of pool for unsupported segment type %s.Temporary logical volume "%s" created.<ܹ,\_tdata_cdata_corig_wcorig_vdata_tdata_cdata_corig_wcorig_vdataLV %s invalid: %s for %s segmentLV %s invalid: %s (is %u) for %s segmentmin recovery larger than max recoveryLV %s invalid: segment %u is referencing different LV.LV %s invalid: segment %u should begin at LE %u (found %u).LV %s: segment %u with len=%u has inconsistent area_len %uLV %s: segment %u has same LV %s for both origin and snapshotLV %s, segment %u invalid: %s for %s segment.is not referencing cache pool LVhas invalid cache metadata formathas invalid cache's feature flagis missing METADATA_FORMAT flagdoes not support flag ERROR_WHEN_FULL.log LV does not point back to mirror segmentregion size is bigger then LV itselflog LV is not a mirror log or a RAID imageLV %s invalid: maximum supported areas %u (is %u) for %s segmentDataLV without RAID image flagMetaLV without RAID metadata flagdata LV does not refer back to pool LVmetadata LV does not refer back to pool LVmust not have pool metadata LV setis not flagged as thin pool LVis a thin volume that must not contain thin pool segmentis not flagged as thin volume LVis a thin pool that must not contain thin volume segmentis not referencing thin pool LVexternal LV is not flagged as a external origin LVmerge LV is not flagged as a thin LVmerge LV is not flagged as mergingis not referencing VDO pool LVLV %s: segment %u has unassigned area %u.LV %s: segment %u has inconsistent PV area %uLV %s: segment %u has inconsistent LV area %uLV %s: segment %u mirror image %u missing mirror ptrLV %s segment %u uses LV %s, but missing ptr from %s to %sLV %s has duplicated links to LV %s segment %uLV %s: mirrored LV segment %u has wrong size %u (should be %u).LV %s: inconsistent LE count %u != %uLV %s is used by LV %s:%u-%u, but missing ptr from %s to %sReference count mismatch: LV %s has %u links to LV %s:%u-%u, which has %u linksLV %s is indirectly used by historical LV %sbut that historical LV does not point back to LV %sLV %s is indirectly used by LV %sbut that LV does not point back to LV %sLV %s must have exactly one segment.LV %s: segment 1 pool data LV does not point back to same LVLV %s: thin pool metadata LV does not use _tmeta.LV %s: cache pool metadata LV does not use _cmeta.LV %s: external origin count does not match.LV %s: external origin cant't be writable.LV segment %s:%u-%u is incorrectly listed as being used by LV %sSegment with extent %u in LV %s not foundUnable to split the %s segment at LE %u in LV %sCouldn't allocate cloned LV segment.LV segment tags duplication failedSplit %s:%u[%u] at %u: %s LE %uSplit %s:%u[%u] at %u: %s PE %uUnassigned area %u found in segmentmetadata/merge.cnon power of 2 region sizemirror image is not mirroredis not flagged as cache LVis missing cache pool LVsets cleaner_policyis missing cache policy namehas invalid chunk size.sets METADATA_FORMAT flagsets cache metadata formatsets cache modesets policy namesets policy settingslog LV is not a mirror logregion size is zero_mlogregion size is non power of 2zero area countzero areasextents_copied too largenon-zero origin LVnon-zero cow LVnon-zero origin_listno DataLVDataLV size variationsno MetaLVMetaLV size variationsno meta areasnon power of 2 stripe sizenon-zero region_sizenon-zero write behindnon-zero min recovery ratenon-zero max recovery ratenon-zero stripe sizeminimum 2 areas requiredminimum 5 areas requiredminimum 4 areas requirednon-zero writebehindbogus RAID segment typeno raid image SubLVvisible raid image LVno raid meta SubLVvisible raid meta LVis missing a pool data LVis missing a pool metadata LVzero_new_blocks is invalidsets zero_new_blockssets discardssets thin_messages listsets CROP_METADATA flagis missing thin pool LVhas too large device idsets device_idsets external LVsets merge LVsets indirect_origin LVis not flagged as VDO pool LVis missing a VDO pool data LVis not VDO pool data LVsets invalid VDO parameter(s)sets vdo_pool_header_sizesets vdo_pool_virtual_extentssets vdo_paramsis not flagged as VDO LVis missing VDO pool LVsets pool LVsets chunk_sizesets transaction_idset segtype_privateLV %s: has no segment._cmetametadata/metadata.csnprintf random bit failed.Skipping clustered VG %s.Failed to add tag %s to %s/%s2.4.#orphansvg_remove_mdas %s failed%s: Couldn't get size.Volume group %s is read-onlyformat_instanceAdding PVs to VG %s.Adding PV %s to VG %s.PV %s has wrong block size.pv allocation failedvg_createFailed to hash mda.SettingClearingignoredin-useFailed to allocate pvid hash.Failed to hash pvid.Failed to allocate uuid hashFailed to hash lvname.Failed to hash lvid.Failed to write VG %s.LV %s dev %s is pmem.LV %s dev %s not pmem.LV %s on pmemnaReading orphan VG %s.Can't get lock for %s.VG name not found for vgid %sVolume group "%s" not foundRescanning devices for %s %sVolume group "%s" not found.Reading VG %s without a lock.Volume group %s is exportedVolume group %s is read-only.Failed to import written VG.vg_devs_checkReading VG %s %sInternal error: Referenced LV %s not listed in VG %s.Internal error: Referenced PV %s not listed in VG %s.Internal error: Invalid character at index %u of lock_args "%s"Internal error: Invalid colon at index %u of lock_args "%s"Failed to allocate bitset for setting random bits.dm_pool_begin_object failed for random list of bits.Failed to generate list of random bits.Failed to finish list of random bits.Selected %u random bits from %u: %sFailed to allocate pv structure.Allowing forced access to clustered vg %sUsing metadata size 960 KiB for non-standard page size %d.Requested PE alignment is %llu sectorsStandard PE alignment is %llu sectorsIncreasing PE alignment to page size %u sectorsAdjusting PE alignment from %llu sectors to md stripe width %llu sectors for %sAdjusting PE alignment from %llu sectors to mininum io size %llu sectors for %sAdjusting PE alignment from %llu sectors to optimal io size %llu sectors for %sSetting PE alignment to %llu sectors for %s.Setting PE alignment offset to %llu sectors for %s.New volume group name "%s" is invalid.%s: already exists in filesystemNew volume group path exceeds maximum length of %d!Old and new volume group names must differvg->name allocation failed for '%s'pv->vg_name allocation failed for '%s'Marking PV %s as moved to VG %sPhysical extent size used for volume group %s is less than logical block size (%u bytes) that %s uses.Logical volume %s/%s does not support tagsFailed to duplicate tag %s from %s/%sVolume group %s does not support tagsFailed to duplicate tag %s from %sFailed to add tag %s to volume group %sMajor number %d outside range 0-255.Minor number %d outside range 0-255.Major number %d outside range 0-4095.Ignoring supplied major %d number - kernel assigns major numbers dynamically.Minor number %d outside range 0-1048575.Volume Group allocation policy cannot inherit from anythingPhysical extent size may not be zeroNumber of volumes may not exceed 255Rounding up size to full physical extent %sVolume too large (%s) for extent size %s. Upper limit is less than %s.Specified size is smaller then physical extent boundary.No free extents in the list of physical volumes.No free extents in Volume group %s.Converted %s%%%s into 0 extents.Converted %s%%%s into %u extents.Internal error: Read ahead data missing.Logical volumes in "%s" must be inactiveExtent sizes differ: %d (%s) and %d (%s)Maximum number of physical volumes (%d) exceeded for "%s" and "%s"Maximum number of logical volumes (%d) exceeded for "%s" and "%s"Metadata types differ for "%s" and "%s"Duplicate logical volume name "%s" in "%s" and "%s"Physical volume %s might be constructed from same volume group %s.Calculated readahead of LV %s is %uVolume group "%s" not found, is inconsistent or has PVs missing.Consider vgreduce --removemissing if metadata is inconsistent.Volume group "%s" still contains %u logical volume(s)WARNING: Device %s has size of %lu sectors which is smaller than corresponding PV size of %lu sectors. Was device resized?Format does not support writing physical volumesAssertion failed: can't _pv_write non-orphan PV (in VG %s)Removing physical volume "%s" from volume group "%s"Failed to remove physical volume "%s" from volume group "%s"Volume group "%s" successfully removedVolume group "%s" not properly removedFailed to clear metadata from physical volume "%s" after removal from "%s"Attempt to modify a read-only VGVolume group %s is not resizeable.Couldn't allocate format_instance object.Adding physical volume '%s' to volume group '%s'pv_list allocation for '%s' failedPhysical volume '%s' is already in volume group '%s'PV %s is used by a VG but its metadata is missing.Physical volume %s is of different format type (%s)Physical volume %s might be constructed from same volume group %sFormat-specific setup of physical volume '%s' failed.Physical volume '%s (%s)' already in the VG.No space for '%s' - volume group '%s' holds max %d physical volume(s).Unable to add %s to %s: new extent count (%lu) exceeds limit (%u).WARNING: PV %s has unknown block size.Devices have inconsistent block sizes (%u and %u)Devices have inconsistent logical block sizes (%u and %u).PV %s cannot be added to VG %s.Failed to create random uuid for %s.WARNING: %s: Overriding real size. You could lose data.%s: Pretending size is %lu sectors.%s: Size must exceed minimum of %lu sectors.pv_list allocation in pv_create failedFormat-specific initialisation of physical volume %s failed.Failed to add metadata area for new physical volume %sPhysical volume %s not in volume group %sLogical volume %s not in volume group %sCannot move PV(s) from non resize volume group %s.Cannot move PV(s) to non resize volume group %s.Failed to read existing physical volume '%s'WARNING: PV %s is marked in use but no VG was found using it.WARNING: PV %s might need repairing.Couldn't create uuid for volume group '%s'.Failed to create format instanceFormat specific setup of volume group '%s' failed.metadata_area allocation failed%s ignored flag for mda %s at offset %lu.Adjusting ignored mdas for %s: %u of %u mdas in use but %u required. Changing %u mda.Internal error: Unable to find %u metadata areas to unignore on volume group %sMetadata areas on physical volume "%s" already ignored.Metadata areas on physical volume "%s" already marked as in-use.Physical volume "%s" has no metadata areas.Marking metadata areas on physical volume "%s" as %s.WARNING: Changing preferred number of copies of VG %s metadata from %u to %uInternal error: LV %s (UUID %s) not found in committed metadata.Internal error: VG %s allocation policy set to invalid cling_by_tags.Internal error: VG %s has external flag LVM_WRITE_LOCKED set internally.Internal error: VG %s tag %s has invalid form.Internal error: PV list corruption detected in VG %s.Internal error: VG %s PV list entry points to different VG %s.Internal error: VG name for PV %s is corrupted.Internal error: Duplicate PV id %s detected for %s in %s.Internal error: PV %s tag %s has invalid form.Internal error: PV segments corrupted in %s.Internal error: LV %s is not marked as removed while it's part of removed LV list for VG %sInternal error: LV %s is marked as removed while it's still part of the VG %sInternal error: LV %s has external flag LVM_WRITE_LOCKED set internally.Internal error: LV name "%s/%s" length %zu is not supported.Internal error: LV %s has VG UUID %s but its VG %s has UUID %sInternal error: LV %s is extra pool metadata spare volume. %u found but only 1 allowed.Internal error: LV %s is not the VG's pool metadata spare volume.Internal error: LV segments corrupted in %s.Internal error: LV %s allocation policy set to invalid cling_by_tags.Internal error: LV name %s has invalid form.Internal error: LV %s tag %s has invalid form.Internal error: #LVs (%u) != #visible LVs (%u) + #snapshots (%u) + #internal LVs (%u) in VG %sFailed to allocate lv_name hashInternal error: Duplicate LV name %s detected in %s.Internal error: Duplicate LV id %s detected for %s in %s.Internal error: Segment in %s is not 2-way.Internal error: Segment in %s has wrong number of areas: %d.Internal error: Volume group %s has limited PV/LV count but limit is not set.Internal error: VG references non pool metadata spare LV %s.Failed to allocate lv_lock_args hashInternal error: VG %s with lock_type %s without lock_argsInternal error: VG %s with lock_type %s is clusteredInternal error: VG %s with lock_type %s has system_id %sInternal error: VG %s has unknown lock_type %sInternal error: VG %s has invalid lock_args charsInternal error: VG %s has lock_args %s without lock_typeInternal error: LV %s/%s has invalid lock_args charsInternal error: LV %s/%s has invalid lock_args "%s"Internal error: LV %s/%s has duplicate lock_args %s.lock_args will be ignored on cache volInternal error: LV %s/%s shouldn't have lock_argsInternal error: LV %s/%s with no lock_type has lock_args %sInternal error: LV %s/%s appearing in VG's historical list is not a historical LVInternal error: Historical LV %s points to different VG %s while it is listed in VG %sInternal error: Historical LV %s has VG UUID %s but its VG %s has UUID %sInternal error: Duplicate historical LV id %s detected for %s in %sInternal error: Duplicate historical LV name %s detected in %sFailed to hash historical LV nameFailed to hash historical LV idInternal error: Name %s appears as live and historical LV at the same time in VG %sInternal error: Historical LV %s is not part of any LV chain in VG %sCannot allocate lock for new LV.Automatically removing historical logical volume %s/%s%s.Failed to handle historical LVs in VG %s.Cannot update partial volume group %s.Cannot update volume group %s while physical volumes are missing.Cannot update volume group %s with duplicate PV devices.Cannot update volume group %s with unknown segments in it!Internal error: Unable to find %u metadata areas to ignore on volume group %sAborting vg_write: No metadata areas to write to!WARNING: wiping mda on outdated PV %sWARNING: failed to wipe mda on outdated PV %s_wipe_outdated_pvs no label for %sWARNING: wiping header on outdated PV %sWARNING: failed to wipe header on outdated PV %sInternal error: Writing metadata in critical section.WARNING: updating PV header on %s for VG %s.WARNING: updating old metadata to %u on %s for VG %s.Format does not support writing volume group metadata areas.WARNING: Failed to write an MDA of VG %s.Failed to destroy record about historical LV %s/%s.Outdated record for historical logical volume "%s" automatically destroyed.Invalid mix of cache device types in %s.WARNING: Couldn't find device with uuid %s.Couldn't find device with uuid %s.WARNING: VG %s was previously updated while PV %s was missing.Found a previously MISSING PV %s with no MDAs.Fixing up missing size (%s) for PV %sWARNING: Physical Volume %s is too large for underlying deviceWARNING: not repairing bad metadata (0x%x) for mda%d on %sWARNING: repairing bad metadata (0x%x) in mda%d at %llu on %s.WARNING: failed to write VG %s metadata to bad mda%d at %llu on %s.WARNING: failed to precommit VG %s metadata to bad mda%d at %llu on %s.WARNING: failed to commit VG %s metadata to bad mda%d at %llu on %s.Volume group name "%s" has invalid characters.WARNING: activating multiple VGs with the same name is dangerous and may fail.Rescan for text mismatch - no mdas.Rescan for text mismatch - no mda dev.Rescan for text mismatch - cannot invalidate.Rescan for text mismatch - no mda header.Rescan for text mismatch - bad_fields.Rescan for text checksum mismatch - now %x prev %x.Rescan for text offset mismatch - now %llu prev %llu.Rescan skipped - unchanged offset %llu checksum %x.Ignoring metadata for VG %s from missing dev.Reading VG %s metadata from %s %lluWARNING: Reading VG %s on %s failed.WARNING: ignoring metadata seqno %u on %s for seqno %u on %s for VG %s.WARNING: Inconsistent metadata found for VG %s.See vgck --updatemetadata to correct inconsistency.VG %s not found on any remaining devices.vg_read %s ignore mda for outdated dev %sWARNING: PV %s in VG %s is using an old PV header, modify the VG to update.WARNING: PV %s in VG %s is missing the used flag in PV header.WARNING: failed to strip outdated historical lvs.VG %s is missing PV %s (last written to %s)WARNING: VG %s is missing PV %s (last written to %s).WARNING: VG %s is missing PV %s.WARNING: VG %s has unused reappeared PV %s %s.WARNING: VG %s was missing PV %s %s.WARNING: One or more devices used as PVs in VG %s have changed sizes.WARNING: Couldn't find all devices for LV %s while checking used and assumed devices.WARNING: Device mismatch detected for %s which is accessing %s instead of %s.Cannot access VG %s with lock type %s that requires lvmlockd.Cannot access VG %s due to failed lock.Test mode is not yet supported with lock type %s.WARNING: Found LVs active in VG %s with foreign system ID %s. Possible data corruption.Cannot access VG %s with system ID %s with unknown local system ID.Cannot access VG %s with system ID %s with local system ID %s.Cannot change VG %s while PVs are missing.See vgreduce --removemissing and vgextend --restoremissing.Cannot change VG %s with unknown segments in it!WARNING: vg_read no vg copy: pool locked.WARNING: vg_read no vg copy: copy exists.WARNING: vg_read no vg copy: pre copy exists.Internal error: Missing committed config tree.Internal error: vg_read vg %p vg_precommitted %pInternal error: vg_read vg %p vg_committed %pTZ\metadata/mirror.c_mimage_%d%s_mimage_%%dAborting. Unable to tag._mlogtmp_%dFailed to create mirror log.Failed to form mirrored log.LV %s assigned to be split.Unable to allocate memory.lvs list alloc failed. and no log volumeFailed to add mirror images.All mimages of %s are gone.%u image(s) removed from %s.coreFailed to convert mirror logNo conversion is requested.Not a mirror segment.Device path name too long - log header not written (%s).Writing log header for LV %s to device %s.%s: not found: log header not written.Failed to open %s/%s to write log header.Failed to write log header to %s.Failed to build new mirror image name for %s.Aborting. Failed to create mirror image LV. Remove new LV and retry.Failed to add mirror image segment to %s. Remove new LV and retry.Aborting. Failed to add mirror image segment to %s. Remove new LV and retry.Aborting. Failed to add mirror segment. Remove new LV and retry.Unable to determine mirror sync status of %s.Intermediate VG commit for orphan volume failed.Failed to sync local devices when reactivating %s.Internal error: Log LV %s is not top level LV for initialization.Test mode: Skipping mirror log initialisation.Aborting. Unable to create in-sync mirror log while activation is disabled.Aborting. Unable to tag mirror log.Aborting. Failed to activate mirror log.Aborting. Failed to wipe mirror log.Aborting. Failed to write mirror log header.Aborting. Failed to deactivate mirror log. Manual intervention required.Aborting. Failed to sync local devices before initialising mirror log %s.Unable to deactivate mirror log LV. Manual intervention required.Manual intervention may be required to remove abandoned log LV before retrying.Manual intervention may be required to remove/restore abandoned log LV before retrying.Failed to build new mirror log name for %s.Adjusting region_size to %s for mirrored log.Failed to initialise mirror log.Failed to find mirror_seg for %sLV %s on %s is not a mirror segments.Using reduced mirror region size of %sUnable to allocate mirror extents for %s.Failed to add mirror areas to %s.Internal error: Unknown mirror flag.Invalid index (%u) of mirror image supplied to shift_mirror_images().Unable to split non-mirrored LV %s.Internal error: split_count is zero!Detaching %d images from mirror %s.Insufficient removable PVs given to satisfy request.Unable to rename newly split LV.Failed to build new mirror, %s.Failed to build new image name for %s.Failed to generate new image names for %s.Failed to group split images into new mirror.Failed to rename newly split LV in the kernelSegment is not mirrored: %s:%uSegment status does not match: %s:%u status:0x%lx/0x%lxReducing mirror set %s from %u to %u image(s)%s.Incompatible parameters to _remove_mirror_images.Internal error: _remove_mirror_images called incorrectly with is_removable undefined.Unable to remove primary mirror image while mirror volume %s is not in-sync.%s being removed due to failures.Failed error target substitution for %s.Failed to initialize log device %s.No mirror images found using specified PVs.%u images are removed out of requested %u.Multiple-segment mirror is not supported.Unable to determine mirror sync status.Full resync required to convert inactive mirror volume %s to core log. Proceed? [y/n]: Logical volume %s NOT converted.Failed to find mirrored LV for %s.Not collapsing %s: out-of-sync.Failed to release mirror imagesUnable to allocate extents for mirror log.Mirror %s already has a %s log.Log type "mirrored" creation/conversion is not supported for regular operation!Log type "mirrored" is DEPRECATED. Use RAID1 LV or disk log instead.%s: Required device-mapper target(s) not detected in your kernel.Unable to allocate extents for mirror(s).Persistent log is not supported on segment-by-segment mirroring.Striped-mirroring is not supported on segment-by-segment mirroring.Unsupported mirror conversion type.%sLogical Volume "%s" already exists in volume group "%s".Unable to split mirror %s that is not in-sync.Removing more than existing: %d <= %d.Mirror log type "%s" is unknown.Internal error: Unknown mirror log count %d.Internal error: Unable to attach pool metadata LV to %s segtype.Internal error: Logical volume %s is not valid pool.Internal error: Unable to attach pool data LV to %s segtype.Internal error: Unable to attach pool to %s/%s that is not cache or thin volume.Internal error: No pool associated with %s LV, %s.Internal error: Cannot detach pool from LV %s.Internal error: Trying to delete %u again.Internal error: Unsupported message type %u.Initialization of historical LV representation for removed logical volume %s failed.Failed to create historical LV representation for removed logical volume %s.%s is referenced by more then one segments (%s, %s).Pool segment not found for %s.%s on %s is not a %s pool segmentInternal error: %s is not a pool logical volume.No usable device hint found while recalculating pool chunk size for %s.Calculated chunk size %s for pool %s is out of allowed range (%s-%s).Updating chunk size %s for pool %s to %s.Internal error: Pool %s already has extents.Name of logical volume %s is too long to be a pool name.WARNING: Pool %s is created without initialization.Aborting. Failed to activate pool metadata %s.Aborting. Failed to wipe pool metadata %s.Aborting. Could not deactivate pool metadata %s.Size %s of pool metadata volume %s is bigger then maximum usable size %s.Reducing pool metadata size %s to maximum usable size %s.Can't use volume %s with size %s as pool metadata. Minimal required size is %s.Extending pool metadata size %s to required minimal size %s.Internal error: LV %s is not pool metadata spare.Internal error: LV %s has no suffix for pool metadata spare.Failed to generate unique name for pool metadata spare logical volume.Renaming existing pool metadata spare logical volume "%s" to "%s/%s".Can't create pool metadata spare. Name of pool LV %s is too long.Renaming %s as pool metadata spare volume %s.Preparing pool metadata spare volume for Volume group %s.Unable to deactivate pool metadata spare LV. Manual intervention required.WARNING: recovery of pools without pool metadata spare LV is not automated.Dropping unused pool metadata spare LV %s.metadata/pool_manip.cDiscarding message for LV %s._cdata_tdata%s_pmsparemetadata/pv.cCannot disable all metadata areas in volume group %s.Internal error: PV %s unexpectedly not in cache.Adding PE range: start PE %u length %u on %s.Overlapping PE ranges specified (%u-%u, %u-%u) on %s.Failed to create PV entry for missing device.WARNING: Physical volume %s not allocatable.WARNING: Physical volume %s is missing.WARNING: No free extents on physical volume "%s".Unable to allocate physical volume list.Allocation of pe_ranges list failed.PE range error: start extent %u to end extent %u.Physical extent parsing error at %s.Physical Volume "%s" not found in Volume Group "%s".No specified PVs have space available.metadata/pv_list.cAllocation of list failed.Skipping invalid tag %s.Failed to clone PV name.pv_segment allocation failedmetadata/pv_manip.c%s %u: %6u %6u: %s(%u:%u)Gap in pvsegs: %u, %uWrong lvseg area typeInconsistent pvseg pointersInconsistent length: %u %uUpdating physical volume "%s"Physical volume "%s" changedSegment with extent %u in PV %s not foundMissing PV segment on %s at %u.discard_pv_segment with unallocated segment: %s PE %uSkipping discard on missing device with uuid %s.Discarding %u extents offset %lu sectors on %s.release_pv_segment with unallocated segment: %s PE %uInternal error: _merge_free_pv_seg called on a segment that is not free.Internal error: WARNING: PV %s is without initialized PE ranges.PV segment pe_count mismatch: %u != %uPV segment pe_alloc_count mismatch: %u != %uPV segment VG pv_count mismatch: %u != %uPV segment VG free_count mismatch: %u != %uPV segment VG extent_count mismatch: %u != %uPhysical volume %s format does not support resizing.WARNING: %s: Overriding real size %s. You could lose data.%s: Requested size %s exceeds real size %s. Proceed? [y/n]: Physical Volume %s not resized.%s: Requested size %s is less than real size %s. Proceed? [y/n]: %s: Size is already %s (%lu sectors).WARNING: %s: Pretending size is %lu not %lu sectors.Resizing volume "%s" to %lu sectors.Size must exceed minimum of %lu sectors on PV %s.Size must exceed physical extent start of %lu sectors on PV %s.Format specific resize of PV %s failed.Size must leave space for at least one physical extent of %u sectors on PV %s.No change to size of physical volume %s.Resizing physical volume %s from %u to %u extents.%s: cannot resize to %u extents as there is only room for %lu.%s: cannot resize to %u extents as %u are allocated.%s: cannot resize to %u extents as later ones are allocated.Failed to store physical volume "%s"Failed to store physical volume "%s" in volume group "%s"Use pvcreate and vgcfgrestore to repair from archived metadata.metadata/pv_map.ccreate_pv_maps alloc failedpvl->pv->devto_go <= pva->countAllowing allocation on %s start PE %u length %uCouldn't create physical volume maps in %sconsume_pv_area_create_mapsmetadata/raid_manip.cFailed to allocate new name.rmetaMemory allocation failed.%s_%s_%%draid0_metaraid10_near (same as %s%s)recoverExtracting %u %s from %s.Failed to extract %s from %s.Shifting images in %s.Shifting %s and %s by %u.Failed to add sublv %s.LV %s in not partial.%s has enough space for %s.Failed to add %s to %s.%s_iorigFailed to get device count.Failed to get device health._extractedraid5_nFailed to resume %s.Post callout function failed._mlog__mimage__rmeta__rimage_%s called on non-raid1 LV._rimage_0Adding %s to %s.Adjust data LVs of %s.Data LV renamed to %s.Can't convert %s LV %s to %s.Adding metadata LVs to %s.Can't convert %s to %s. losing %s resilienceRemoving mirror log %s.Failed to remove mirror log.Setting new segtype for %s.Renaming %s to %s.raid1 with reducingenhancingLogical volume %s NOT split. to %s typeRea--stripes-I/--stripesize-R/--regionsize? [y/n]: dm_snprintf failed.LV %s already has %u stripes.Too few stripes requested.Converting %s from %s to %s.Internal error: Missing image sub lv in area %u of LV %s.Internal error: bogus reshape space reallocation request [%d]Logical volume %s is already of requested type %s.Failed to new raid name for %s.New logical volume name "%s" is not valid.%sLogical Volume %s already exists in volume group %s.Extracting image components %s and %s from %s.Internal error: Unable to remove RAID layer from segment type %s.Internal error: Unable to remove RAID layer when there is more than one sub-lv.Activating logical volume %s before %s in kernel.Failed to activate %s before resuming %s.Internal error: stripes may not be 0.Can't convert %s LV %s with number of stripes not divisable by number of data copies.Internal error: LV %s is missing stripes.Failed to find a valid mirror in stripe %u!Internal error: Bad type provided to _alloc_raid_component.Component name for raid %s is too long.Failed to allocate new raid component, %s.Failed to add segment to LV, %s.No proper new segment length for %s!Region size may not be smaller than stripe size on %s LV %s.Region size is too large for %s LV %s.Cannot restripe LV %s from %u to %u stripes during conversion.Cannot determine sync percentage of %s.Unable to determine sync status of %s.WARNING: Sync status for %s is inconsistent.Can't remove reshape space from inactive LV %s.Can't get data offset for %s from kernel.Failed to allocate out-of-place reshape space for %s.Internal error: Bogus reshape space allocation request.%s not allowed when converting %s LV %s.%s not allowed for LV %s when converting from %s to %s.An entire mirror group has failed in %s.All components of raid LV %s have failed.More than %u components from %s %s have failed.%s contains a segment incapable of degraded activation.Unable to remove primary RAID image while array resyncing.Unable to remove RAID image while array is performing "%s"Internal error: RAID LV area_count differs from number of health charactersUnable to remove all primary source devicesUnable to remove %d images: Only %d device%s given.%s has components with error targets that must be removed first: %s.Try removing the PV list and rerun. the command.LVs with error segments to be removed: %s %sInternal error: Metadata segment area. #%d should be AREA_UNASSIGNED.Failed to shift and rename image components.Unable to extract enough images to satisfy request.Internal error: LVs must be set visible before removing.Failed to sync local devices after removing %u LVs in VG %s.Direct conversion of %s LV %s is not possible.Converting %s from %s%s is directly possible to the following layout%s:Logical volume %s already is type %s.Converting the segment type for %s from %s to %s is not supported.Converting the segment type for %s from %s to %s is not supported yet.Failed to prevent PVs holding image components from LV %s being used for allocation.Can't rebuild raid with integrity.Can't replace any devices in %s LV %s.%s must be active to perform this operation.Unable to replace devices in %s while it is not in-sync.Unable to repair %s/%s. Source devices failed before the RAID could synchronize.You should choose one of the following: 1) deactivate %s/%s, revive failed device, re-activate LV, and proceed. 2) remove the LV (all data is lost). 3) Seek expert advice to attempt to salvage any data from remaining devices.Unable to replace RAID images while the array has unassigned areas.Logical volume %s does not contain devices specified to %s.%s does not contain devices specified to %s.Unable to %s all PVs from %s at once.Unable to %s more than %u PVs from (%s) %s.Unable to %s all the devices in a RAID10 mirror group.Failed to prevent PVs holding image components from being used for allocation.Failed to replace %u devices. Attempting to replace %u instead.%u extents needed to repair %s.Not enough space on %s for %s.Failed to allocate replacement images for %s.Failed to remove the specified images from %s.Internal error: Bad type provided to %s.Extracting image component %s from %s.Extracting all MetaLVs of %s to activate as raid0.Deactivating pulled out MetaLVs of %s before initializing.Clearing allocated raid0_meta metadata LVs for conversion to raid4.Failed to initialize metadata LVs.Adding metadata LVs back into %s.LV %s has to be of type raid4 or raid5_n to allow for this conversion.Unable to convert %s while it is not in-sync.Are you sure you want to convert %s%s LV %s to %s%s type? [y/n]: Logical volume %s NOT converted to "%s".Converting LV %s from %s to %s.Failed to rename %s LV %s MetaLVs.Internal error: Pre callout function failed.Clearing any flags for %s passed to the kernel.Updating metadata mappings for %s.Adjusting region_size from %s to %s for %s.Adjusting region size of %s LV from %s to %s.Internal error: Cannot change region size of %s.Region size is already %s on %s LV %s.Region size is already matching %s on %s LV %s due to adjustment.Do you really want to change the region_size %s of LV %s to %s? [y/n]: Region size %s on %s is too small for metadata LV size.Unable to change region size on %s LV %s while it is not in-sync.Converting %s LV %s to regionsize %s.Changed region size on %s LV %s to %s.Failed to allocate string for new LV name.Internal error: Unable to allocate RAID metadata area for non-linear LV %s.Can't change number of mirrors of degraded %s.Please run "lvconvert --repair %s" first.WARNING: %s already has image count of %d.Failed to extract images from %s.Integrity must be removed before converting raid to linear.Are you sure you want to convert %s LV %s to type %s losing all resilience? [y/n]: Failed to remove RAID layer after linear conversion.Can't add image to out-of-sync RAID LV: use 'lvchange --resync' first.Can't add image to RAID LV that is still initializing.RAID module does not support rebuild+emptymeta.Unable to add RAID images to %s of segment type %s.Allocation of new areas failed.Allocation of new meta areas failed.Failed to clear REBUILD flag for %s components.%s is out-of-sync! Please try refreshing first.Are you sure you want to convert %s back to the older %s type? [y/n]: Internal error: raid1 conversion supported only.can't convert %s to fewer than 2 data_copies.Unable to handle mirrors with more than %u devices.Unable to convert %s LV %s with %u images to %s.At least reduce to the maximum of %u images with "lvconvert -m%u %s".Changing image count to %u on %s.Extracting and renaming metadata LVs.Internal error: Name %s lags image part.Allocating metadata LVs for %s.Allocating new metadata LV for %s.Failed to allocate metadata LV for %s.Failed to allocate metadata LVs for %s.Clearing newly allocated metadata LVs for %s.Failed to initialize metadata LVs for %s.Adding newly allocated metadata LVs to %s.Failed to add newly allocated metadata LVs to %s.Internal error: No segment for %s.Failed to retrieve raid0 segments from %s.Cannot convert striped LV %s with varying stripe count to raid0.Cannot convert striped LV %s with non-power of 2 stripe size %u.Failed to allocate empty image components for raid0 LV %s.Failed to insert linear LVs underneath %s.Failed to allocate new raid0 segment for LV %s.N number of data_copies "--mirrors N-1" may not be larger than number of stripes.Minimum of %u stripes needed for conversion from %s to %s.Can't convert %s LV %s to %s with != 2 legs.Internal error: Bogus new_image_count converting %s LV %s to %s.Adding %u component LV pair(s) to %s.Extracting last image component pair of %s temporarily.Adding extracted last image component pair back to %s to convert to %s.Updating VG metadata and reloading %s LV %s.Reordering areas for raid0 -> raid10_near takeover.Can't convert %s LV %s to %s with odd number of stripes.Can't convert %s LV %s to %s with < 3 legs.Reordering areas for raid10 -> raid0 takeover.Removing %u component LV pair(s) to %s.Failed to allocate meta areas memory.Clearing newly allocated metadata LVs.Failed to allocate metadata LV for %s in %s.Are you sure you want to convert %s LV %s to %s%u images %s resilience? [y/n]: Splitting raid image is not allowed with lock_type %s.Integrity must be removed before splitting.Unable to split more than one image from %s.Unable to split logical volume of segment type, %s.%sLogical Volume "%s" already exists in %s.Unable to split %s while it is not in-sync.Are you sure you want to split %s LV %s losing all resilience? [y/n]: Losing all resilience for logical volume %s.Unable to split additional image from %s while tracking changes for %s.Failed to write changes for %s.Failed to suspend %s before committing changes.Failed to commit changes for %s.Failed to resume %s after committing changes.Unable to split images from non-mirrored RAID.Unable to split image from %s while not in-sync.Cannot track more than one split image at a time.Are you sure you want to split and track %s LV %s losing resilience for any newly written data? [y/n]: Losing resilience for newly written data on logical volume %s.%s split from %s for read-only purposes.WARNING: Any newly written data will be non-resilient on LV %s during the split!Use 'lvconvert --merge %s' to merge back into %s.Unable to find image to satisfy request.%s cannot be merged because --trackchanges was not used.Unable to merge non-raid image %s.Unable to find containing RAID array for %s.Failed to find meta for %s in RAID array %s.Failed to deactivate %s before merging.%s successfully merged back into %s.Internal error: New segtype not specified.Unable to handle raid arrays with more than %u devices.Checking LV %s requested %s segment type for convenienceConvert %s LV %s to 2 images first.Converting %s LV %s to 2 stripes first.Converting %s LV %s to %u stripes first.Convert %s LV %s to raid4/raid5 first.Convert %s LV %s to 2 stripes first (i.e. --stripes 1).Replaced LV type %s%s with possible type %s.Repeat this command to convert to %s after an interim conversion has finished.Unable to convert LV %s from %s to %s.WARNING: ignoring --stripes option on takeover of %s (reshape afterwards).WARNING: ignoring --stripesize option on takeover of %s (reshape afterwards).Are you sure you want to convert %s LV %sCan't convert RAID LV %s while under snapshot.RAID module does not support reshape.Region size may not be smaller than stripe size on LV %s.Can't remove stripes from raid10.Unable to convert stacked volume %s.Internal error: Failed to free reshape space of %s.No change in RAID LV %s layout, freeing reshape space.LV %s does not have reshape space allocated.Can't reshape out of sync LV %s.Device count is incorrect. Forgotten "lvconvert --stripes %d %s" to remove %u images after reshape?Internal error: Bad return=%d provided to %s.Converting stripesize %s of %s LV %s to %s.Ignoring layout change on device adding reshape.Can't reshape %s LV %s to odd number of stripes.WARNING: Adding stripes to active%s logical volume %s will grow it from %u to %u extents!Run "lvresize -l%u %s" to shrink it or use the additional capacity.Are you sure you want to add %u images to %s LV %s? [y/n]: Adding %u data and metadata image LV pair%s to %s.Failed to adjust LV %s to new size!Allocating reshape space for %s.(Re)allocating reshape space for %s.Setting delta disk flag on new data LVs of %s.Minimum 3 stripes required for %s LV %s.Ignoring layout change on device removing reshape.WARNING: Removing stripes from active%s logical volume %s will shrink it from %s to %s!THIS MAY DESTROY (PARTS OF) YOUR DATA!Interrupt the conversion and run "lvresize -y -l%u %s" to keep the current size if not done already!If that leaves the logical volume larger than %llu extents due to stripe rounding,you may want to grow the content afterwards (filesystem etc.)WARNING: to remove freed stripes after the conversion has finished, you have to run "lvconvert --stripes %u %s"Can't remove stripes without --force option.Are you sure you want to remove %u images from %s LV %s? [y/n]: No correct kernel/lvm active LV count on %s.No correct kernel/lvm total LV count on %s.Removing %u data and metadata image LV pair%s from %s.Internal error: Bad return provided to %s.WARNING: ignoring --stripesize on conversion of %s to 1 stripe.Converting %s%s LV %s to %s%s.Are you sure you want to convert %s LV %s? [y/n]: %sllocating reshape space for %s.Reshape request failed on LV %s.Invalid conversion request on %s.Can't convert %s LV %s to %s containing sub LVs to remove after a reshape.Run "lvconvert --stripes %u %s" first.Internal error: %s is not a partial LV.Attempting to remove missing devices from %s LV, %s.Replacing %s segments with error target.Failed to replace %s's extents with error target.Integrity must be removed before degraded or partial activation of raid._extract_image_component_error_seg_raid_reshape_remove_images_raid_reshapemetadata/segtype.cWARNING: Unrecognised segment type %sInternal error: Unrecognised segment type flag 0x%016lxmetadata/snapshot_manip.csnapshot%dlocked volumespvmoved volumeshidden volumescache type volumesthin pool type volumesmirror subvolumesraid subvolumesraid with integritySnapshot volume cannot be smaller than 3 chunks (%u extents, %s).Internal error: Cannot get origin from snapshot %s.'%s' is already in use as a snapshot.Snapshot and origin LVs must differ.Failed to find snapshot segtypeCouldn't allocate new snapshot segment.Failed to sync local devices before deactivating origin LV %s.Failed to deactivate logical volume "%s"Failed to remove internal snapshot LV %sPostponing write and commit for remove of snapshot %s.Failed to refresh %s without snapshot.an origin that has a merging snapshotWARNING: Snapshots of mirrors can deadlock under rare device failures.WARNING: Consider using the raid1 mirror type to avoid this.WARNING: See global/mirror_segtype_default in lvm.conf.Snapshots of %s are not supported.Internal error: data_lv_from_thin_pool arg not thin pool %sInternal error: LV %s already has external origin.Setting logical volume "%s" read-only.Internal error: Inconsitent external origin.Internal error: LV %s is not pool.Internal error: Cannot attach message to non-pool LV %s.Message referring LV %s already queued in pool %s.Delete for device %u already queued in pool %s.Failed to allocate memory for message.Internal error: pool_is_active called with non-pool volume %s.Pool's thin volume %s is active.Internal error: LV %s is not thin pool.WARNING: Thin pool %s%s%s%s%s%s.Threshold configured for free data space in thin pool %s has been reached (%s%% >= %s%%).WARNING: Remaining free space in metadata of thin pool %s is too low (%s%% >= %s%%). Resize is recommended.Threshold configured for free metadata space in thin pool %s has been reached (%s%% > %s%%).WARNING: Thin pool %s has unexpected transaction id %lu, expecting %lu%s. and the size of whole volume group and the amount of free space in volume groupWARNING: Sum of all thin volume sizes (%s) exceeds the size of thin pool%s%s%s (%s).WARNING: You have not turned on protection against thin pools running out of space.WARNING: Set activation/thin_pool_autoextend_threshold below 100 to trigger automatic extension of thin pools before they get full.WARNING: Set activation/thin_pool_autoextend_percent above 0 to specify by how much to extend thin pools reaching the threshold.Can't use "%s" as external origin with "%s" pool. Size %s is not a multiple of pool's chunk size %s.Internal error: Segment in %s is not a thin pool segment., perhaps skipped in lvm.conf volume_list?Internal error: Updated LV %s is not pool.Cannot activate thin pool %s%sPool %s needs to be locally active for threshold check.Free space in pool %s is above threshold, new volumes are not allowed.Failed to suspend %s with queued messages.Failed to sync local devices LV %s.Internal error: Cannot find configuration.Thin pool chunk size calculation policy "%s" is unrecognised.Using metadata size without cropping.Thin pool discards type "%s" is unknown.Internal error: Unknown discards type encountered.Cannot read thin pool %s transaction id locally, perhaps skipped in lvm.conf volume_list?Cannot use thin pool %s with transaction id %lu for thin volumes. Expected transaction id %lu.Deactivating public thin pool %s.Aborting. Could not deactivate thin pool %s.Thin pool chunk size %s is not in the range %s to %s.Thin pool chunk size %s must be a multiple of %s.Chunk size must be a power of 2 for this thin target version.Internal error: Could not find configuration.WARNING: Chunk size is too small for pool, suggested minimum is %s.WARNING: Chunk size is smaller then suggested minimum size %s.Selected chunk size %s cannot address more then %s of thin pool data space.Thin pool volume with chunk size %s can address at most %s of data.WARNING: Pool zeroing and %s large chunk size slows down thin provisioning.WARNING: Consider disabling zeroing (-Zn) or using smaller chunk size (<%s).metadata/thin_manip.cAdded %s message. has read-only metadata is erroring needs check is out of data space is failed or lower by 1no free space in volume groupLV %s has no segment.Cannot find free device_id.Found free pool device_id %u.performanceCropping metadata size to %s.Setting chunk size %s.Enabling%s pool zeroing on default.Failed to build device path for VDO formating of data volume %s.Slab size %s converted to %u bits.Internal error: Unable to find configuration for vdoformat command options.Invalid string in config file: global/vdoformat_options.Internal error: Failed to wipe logical VDO data for volume %s.WARNING: Cannot read output from %s.Logical blocks defaulted to %lu blocksAvailable VDO logical blocks %lu (%s).Number of VDO logical blocks was not provided by vdo_format output.Using bigger VDO virtual size unaligned on extent size by %s.Internal error: Unrecognized compression state: %u.Internal error: Unrecognized index state: %u.Internal error: Unrecognized operating mode: %u.Internal error: Unrecognized VDO write policy: %u.Failed to build VDO DM name %s.Cannot parse %s VDO pool status %s.statistics/logical_blocks_usedRounding size up to 4,00 KiB VDO logical extent boundary: %s.Test mode: Skipping formating of VDO pool volume.Cannot format VDO pool volume %s.Cannot deactivate formated VDO pool volume %s.Cannot create fully fitting VDO volume, --virtualsize has to be specified.Size %s for VDO volume cannot be smaller then extent size %s.Sysinfo free:%lu bufferram:%lu sharedram:%lu freehigh:%lu unit:%u.Failing to parse value from %s. %s RAM for physical volume size %s%s %s RAM for virtual volume size %s%s %s RAM for block map cache size %s%sNot enough free memory for VDO target. %s RAM is required, but only %s RAM is available.VDO requires %s RAM, currently available %s RAM.metadata/vdo_manip.c--logical-size=%luK--slab-bits=%u--uds-memory-size=%u--uds-memory-size=0.%u--uds-sparseCommand %s failed.%s/block/dm-%d/vdo/%sFailed to build kvdo path.%skvdo/%s/%sstrtoolofflineclosedopeningclosingrecoveringnormalasyncasync-unsafestatistics/data_blocks_usedSkiping VDO formating %s._vdataUnknown VDO write policy %s.AnonPagesMemAvailableMemFreeMemTotalShmemSwapFree/proc/meminfoParsed %s = %lu KiB. %s RAM for index memoryVDO configuration needs%s. and$4DTdNew size %lu for %s%s not an exact number of new extents.New extent count %lu for %s%s exceeds 32 bits.Internal error: global memory pool used for VG %sFailed to allocate VG hostname hashtable.Failed to allocate volume group structureSetting mda_copies to %u for VG %sPhysical Extent size must be a multiple of %s when not a power of 2.Metadata format only supports Physical Extent sizes that are powers of 2.Extent size must be between %s and %sExtent size must be multiple of %sVolume group "%s" must be resizeable to change PE sizeNew extent size is not a perfect fitVolume group "%s" must be resizeable to change MaxLogicalVolumeMaxLogicalVolume is less than the current number %d of LVs for %sVolume group "%s" must be resizeable to change MaxPhysicalVolumesMaxPhysicalVolume limit is 255MaxPhysicalVolumes is less than the current number %d of PVs for "%s"Failed to allocate memory for system_id in vg_set_system_id.Physical volume "%s" still in useCan't remove final physical volume "%s" from volume group "%s"Removing "%s" from volume group "%s"Cannot remove final metadata area on "%s" from "%s"Removal of physical volume "%s" from "%s" failedRemoved "%s" from volume group "%s"metadata/vg.cFreeing VG %s at %p.Failed to allocate VG name.Allocated VG %s at %p. free space allocated space PV segment start PV segment length area length extents moved virtual extents pvseg start pvseg length area startMaxLogicalVolume limit is 255vg_set_lock_type %s no memInternal error: VG is NULL.No device found for PV.vgreduce_single VG %s PV %sMirrored transient status: "%s"Active mirror has a wrong number of mirror images!Metadata says %u, kernel says %u.Check for existence of mirror log %s failed.Mirror log mismatch. Metadata says %d:%d, kernel says %u:%u.Check for existence of mirror image %s failed.Failed to find image %d (%d:%d).Couldn't read 'extents_moved' for segment %s of logical volume %s.Couldn't read 'region_size' for segment %s of logical volume %s.Unrecognised mirror log in segment %s of logical volume %s.Missing region size for mirror log for segment %s of logical volume %s.Couldn't find mirrors array for segment %s of logical volume %s.mirror string list allocation failedstruct mirr_state allocation failedMissing region size for mirror segment.Failed to build uuid for log LV %s.Failed to build uuid for mirror LV %s.WARNING: Mirror %s without monitoring will not react on failures.Couldn't read 'mirror_count' for segment '%s'.mirror/mirrored.cFound mirror log at %d:%dStatus of log (%d:%d): %c.Found mirror image at %d:%dStatus of image %d: %c.extents_movedmirror_count = %uextents_moved = %umirror_log = "%s"region_size = %u Mirrors %u Mirror size %u Mirror log volume %s Mirror region size %s Mirror original: Mirror destinations:mirror_count0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-misc/lvm-exec.cExecuting:%sforkexecvpChild %u exited abnormally%s failed: %upipePiping:%s/dev/nullpipe[0]STDOUTpipe[1]STDINwaitpidInternal error: Missing command.Failed to sync local device names before forking.wait4 child process %u failed: %smisc/lvm-file.cgethostname%s/.lvm_%s_%d_%d%s: rename to %s failedsync_dir failed in strdupF_WRLCKF_RDLCKLocking %s (%s, %hd)fcntlUnlocking fd %d%s: write errorNot enough space to build temporary file string.fcntl_lock_file failed in strdup._undo_flock %smisc/lvm-flock.cUnlocking %sflock_drop_shared_flock %s._do_flock %s %c%cGiving up waiting for lock.Unrecognised lock type: %dLocking %s %c%c convertLocking %s %c%cFailed to convert flock on %s %dTEST MODE: Metadata will NOT be updated and volumes will not be (de)activated.LVM activation checks disabledmisc/lvm-globals.c%s[%d]LVM udev checking enabledLVM udev checking disabledLVM activation checks enabled[unknown]misc/lvm-signal.csigprocmasksigactionSIG_SETMASKInterrupted..._block_signalssigfillsetSIGINTSIGTERMNames starting "%s" are reserved. Please choose a different LV name.Names including "%s" are reserved. Please choose a different LV name.Failed to build LVM dlid for %s.Internal error: Name is too long.misc/lvm-string.c_cdata_cmeta_corig_cpool_cvol_wcorig_mimage_mlog_rimage_rmeta_tdata_tmeta_vdata_imeta_iorig_pmspare_voriginpvmovesnapshotUdev library context not set.misc/lvm-wrappers.cCould not get udev state.Assuming udev is not running.read_urandom: /dev/urandom/run/cmirrord.pidFailed to create udev library context.WARNING: Failed to reserve memory, %d bytes missing.Allocation of maps buffer failed.%s area unreadable %s : Skipping.%s ignore filter '%s' matches '%s': Skipping.%s default filter '%s' matches '%s': Skipping.%s_filter '%s' matches '%s': Skipping.%s %10ldKiB %12lx - %12lx %c%c%c%c%sLock: Memlock counters: prioritized:%d locked:%d critical:%d daemon:%d suspended:%dRaised task priority %d -> %d.WARNING: setpriority %d failed: %s.Restoring original task priority %d.WARNING: setpriority %u failed: %s.Unlock: Memlock counters: prioritized:%d locked:%d critical:%d daemon:%d suspended:%dInternal error: Reserved memory (%ld) not enough: used %ld. Increase activation/reserved_memory?Suppressed internal error: Maps lock %ld < unlock %ld, a one-page difference.Entering critical section (%s).Entering prioritized section (%s).Leaving critical section (%s).Internal error: _memlock_inc_daemon used in critical section.memlock_count_daemon inc to %dInternal error: _memlock_count_daemon has dropped below 0.memlock_count_daemon dec to %dmm/memlock.c[vectors][vdso][vsyscall]locale/locale-archiveUnlmunlockalllseekmunlock%lx-%lx %c%c%c%c%nFailed to parse maps line: %s%socked %ld bytesLocking memory%s/self/mapsproc_dir too longgetpriorityUnlocking memoryLeaving section (%s).memlock reset./LC_MESSAGES/gconv/gconv-modules.cache/ld-2./libaio.so./libattr.so./libblkid.so./libbz2.so./libcap.so./libdl-/libdw-/libelf-/libgcrypt.so./libgpg-error.so./liblz4.so./liblzma.so./libmount.so./libncurses.so./libpcre.so./libpcre2-/libreadline.so./libedit.so./libresolv-/libselinux.so./libsepol.so./libsystemd.so./libtinfo.so./libudev.so./libuuid.so./libz.so./etc/selinuxFailed to connect to dbus: %dnotify/lvmnotify.ccom.redhat.lvmdbus1Nofify dbus at %s.ExternalEventcom.redhat.lvmdbus1.Manager/com/redhat/lvmdbus1/ManagerWARNING: %s: %sorg.freedesktop.systemd1.NoSuchUnitorg.freedesktop.DBus.Error.ServiceUnknownFailed to parse dbus response message: %dBad return value from dbus service: %dD-Bus notification failedFunction not implementedproperties/prop_common.cInvalid property name %sProperty name %s does not match type %dUnable to set read-only property %sshrinkingrebuild+emptymetareshapingraid/raid.cRaid transient status %s.raid0_lvsstripe_sizeNo areas found for segment %sraid0_lvstripe_count = %ustripe_size = %udevice_count = %uwritebehind = %umin_recovery_rate = %umax_recovery_rate = %udata_offset = %u Raid Data LV%2d Raid Metadata LV%2d %sdevice_countstripe_countTarget raid does not support %s.Active raid has a wrong number of raid images!Check for existence of raid meta %s failed.Check for existence of raid image %s failed.RAID target does not support RAID4 for LV %s.Internal error: _raid_add_target_line called with no areas for %s.Unable to handle more than %u devices in a single RAID arrayMissing region size for raid segment in %s.Internal error: Invalid request for delta disks minus and delta disks plus!Couldn't read '%s' for segment %s of logical volume %s.Couldn't find RAID array for segment %s of logical volume %s.Missing data device in areas array for segment %s.Failed to import RAID component pairs.raid module string list allocation failedCouldn't read 'device_count' or 'stripe_count' for segment '%s'.Only one of 'device_count' and 'stripe_count' allowed for segment '%s'.Failed to allocate memory for %s segtyperaid0raid0_metaraid1raid10 raid10_near raid4@raid5raid5_nraid5_laraid5_lsraid5_raraid5_rsraid6@raid6_n_6raid6_ncraid6_nr raid6_zr@raid6_ls_6raid6_rs_6raid6_la_6raid6_ra_6report/properties.clv_full_namelv_pathlv_dm_pathlv_parentlv_layoutlv_rolelv_initial_image_synclv_image_syncedlv_merginglv_convertinglv_allocation_policylv_allocation_lockedlv_fixed_minorlv_skip_activationlv_autoactivationlv_when_fulllv_activelv_active_locallylv_active_remotelylv_active_exclusivelylv_majorlv_minorlv_read_aheadlv_sizelv_metadata_sizeseg_countorigin_uuidorigin_sizelv_ancestorslv_full_ancestorslv_descendantslv_full_descendantsraid_mismatch_countraid_sync_actionraid_write_behindraid_min_recovery_rateraid_max_recovery_rateintegritymismatchesmove_pvmove_pv_uuidconvert_lvconvert_lv_uuidmirror_log_uuidmetadata_lvmetadata_lv_uuidpool_lvpool_lv_uuidlv_tagslv_profilelv_lockargslv_timelv_time_removedlv_hostlv_moduleslv_historicallv_kernel_majorlv_kernel_minorlv_kernel_read_aheadlv_permissionslv_suspendedlv_live_tablelv_inactive_tablelv_device_opensnap_percentmetadata_percentcopy_percentsync_percentcache_used_blockscache_dirty_blockscache_read_hitscache_read_missescache_write_hitscache_write_misseskernel_cache_settingskernel_cache_policykernel_metadata_formatlv_health_statuskernel_discardslv_check_neededlv_merge_failedlv_snapshot_invalidvdo_operating_modevdo_compression_statevdo_index_statevdo_used_sizevdo_saving_percentwritecache_total_blockswritecache_free_blockswritecache_writeback_blockswritecache_errorlv_attrpv_fmtpv_majorpv_minorpv_mda_freepv_mda_sizepv_ext_vsnpv_sizepv_freepv_usedpv_attrpv_allocatablepv_exportedpv_missingpv_pe_countpv_pe_alloc_countpv_tagspv_mda_countpv_mda_used_countpv_ba_startpv_ba_sizepv_in_usepv_duplicatepv_device_idpv_device_id_typevg_fmtvg_uuidvg_attrvg_permissionsvg_extendablevg_exportedvg_autoactivationvg_partialvg_allocation_policyvg_clusteredvg_sharedvg_sizevg_freevg_sysidvg_systemidvg_lock_typevg_lock_argsvg_extent_sizevg_extent_countvg_free_countvg_missing_pv_countlv_countsnap_countvg_seqnovg_tagsvg_profilevg_mda_countvg_mda_used_countvg_mda_freevg_mda_sizevg_mda_copiesdata_stripesreshape_lenreshape_len_lenew_data_offsetparity_chunksthin_countthin_idseg_start_peseg_size_peseg_tagsseg_pe_rangesseg_le_rangesseg_metadata_le_rangesmetadata_devicesseg_monitorvdo_compressionvdo_deduplicationvdo_block_map_cache_sizevdo_block_map_era_lengthvdo_index_memory_sizevdo_slab_sizevdo_header_sizepvseg_sizereport/report.cdm_pool_strdup failedrefresh neededmismatches existout_of_datalvname snprintf failedagotime_now@%ld:@%ldskip activationqueue_dup_Failed to get segtype name.Failed to allocate buffer.lvm2_Log sequence number.Log type.Current context.Current object type.Current object name.Current object ID.Current object group.Current object group ID.Log message.Errno.Return code.Description of Device Type.Unique identifier.LV layout.LV role.Set if LV is being converted.LV allocation policy.Active state of the LV.Size of LV in current units.Number of segments in LV.The integrity modeThe integrity block sizeTags, if any.Set if the LV is historical.The writecache block sizeLV permissions.Set if LV is suspended.Set if LV device is open.Total cache blocks.Used cache blocks.Dirty cache blocks.Cache read hits.Cache read misses.Cache write hits.Cache write misses.Cache policy used in kernel.LV health status.Set if snapshot merge failed.Total writecache blocks.Total writecache free blocks.Total writecache errors.Type of metadata.Name.Device major number.Device minor number.PV header extension version.Size of PV in current units.Set if PV is used.Device ID such as the WWID.VG permissions.Set if VG is extendable.Set if VG is exported.Set if VG is partial.VG allocation policy.Set if VG is clustered.Set if VG is shared.Number of PVs in VG.Number of LVs.Number of snapshots.Type of LV segment.Number of data copies.Sparse indexing (vdopool).IO enqueue (vdopool).Number of extents in segment.Device Typesdevtype_vg_Logical Volumelv_Logical Volume Device InfoLogical Volume Device StatusPhysical Volumepv_Physical Volume LabelLogical Volume SegmentPhysical Volume Segmentpvseg_Command Logqueue when fullqueue if no spaceerror when fullerror if no spaceread-only-overridero-overrider-overridewriteableread-writecheck neededinactive table presentinactive tableinactivelive table presentlive tablelivesnapshot invalidmerge failedactive exclusivelyactive remotelyactive locallyfixed minorfixedallocation lockedimage syncedinitial image syncunmanagedundeftodayyesterdaySundaySunMondayMonTuesdayTueWednesdayWedThursdayThuFridayFriSaturdaySatnoonmidnightsecondsecminutehourhrAMPMweekmonthyearyrJanuaryJanFebruaryFebMarchMarAprilAprMayJuneJunJulyJulAugustAugSeptemberSepOctoberOctNovemberNovDecemberDecFailed to allocate buffer for mode.alloc_time_item: dm_pool_zalloc failed_get_glv_str: dm_snprintf failed_get_now: dm_pool_zalloc failed_get_now: failed to cache current time_preparse_fuzzy_time: dm_pool_alloc failedUnrecognized string in date/time specification at "%s".Unrecognized number in date/time specification at "%s".Mixed absolute and relative date specification found at "%s".Ambiguous date specification found at "%s".Mixed absolute and relative time specification found at "%s".Ambiguous time specification found at "%s"._translate_time_items: invalid time._translate_time_items: dm_snprintf failed_translate_time_items: dm_pool_strdup failedFailed to get value for parsed time specification.Failed to allocate space to store time range.Failed to allocate buffer for host.Failed to allocate buffer for time.Failed to allocate buffer for active.Failed to display role for LV %s/%s.Failed to display layout for LV %s/%s.Name of Device Type exactly as it appears in /proc/devices.Maximum number of partitions. (How many device minor numbers get reserved for each device.)Name. LVs created for internal use are enclosed in brackets.Full name of LV including its VG, namely VG/LV.Full pathname for LV. Blank for internal LVs.Internal device-mapper pathname for LV (in /dev/mapper directory).For LVs that are components of another LV, the parent LV.Set if mirror/RAID images underwent initial resynchronization.Set if mirror/RAID image is synchronized.Set if snapshot LV is being merged to origin.Set if LV is locked against allocation changes.Set if LV has fixed minor number assigned.Set if LV is skipped on activation.Set if LV autoactivation is enabled.For thin pools, behavior when full.Set if the LV is active locally.Set if the LV is active remotely.Set if the LV is active exclusively.Persistent major number or -1 if not persistent.Persistent minor number or -1 if not persistent.Read ahead setting in current units.For thin and cache pools, the size of the LV that holds the metadata.For snapshots and thins, the origin device of this LV.For snapshots and thins, the UUID of origin device of this LV.For snapshots, the size of the origin device of this LV.LV ancestors ignoring any stored history of the ancestry chain.LV ancestors including stored history of the ancestry chain.LV descendants ignoring any stored history of the ancestry chain.LV descendants including stored history of the ancestry chain.For RAID, number of mismatches found or repaired.For RAID, the current synchronization action being performed.For RAID1, the number of outstanding writes allowed to writemostly devices.For RAID1, the minimum recovery I/O load in kiB/sec/disk.For RAID1, the maximum recovery I/O load in kiB/sec/disk.The number of integrity mismatches.For pvmove, Source PV of temporary LV created by pvmove.For pvmove, the UUID of Source PV of temporary LV created by pvmove.For lvconvert, Name of temporary LV created by lvconvert.For lvconvert, UUID of temporary LV created by lvconvert.For mirrors, the LV holding the synchronisation log.For mirrors, the UUID of the LV holding the synchronisation log.For cache/thin/vdo pools, the LV holding the associated data.For cache/thin/vdo pools, the UUID of the LV holding the associated data.For cache/thin pools, the LV holding the associated metadata.For cache/thin pools, the UUID of the LV holding the associated metadata.For cache/thin/vdo volumes, the cache/thin/vdo pool LV for this volume.For cache/thin/vdo volumes, the UUID of the cache/thin/vdo pool LV for this volume.Configuration profile attached to this LV.Lock args of the LV used by lvmlockd.Creation time of the LV, if knownRemoval time of the LV, if knownCreation host of the LV, if known.Kernel device-mapper modules required for this LV.Currently assigned major number or -1 if LV is not active.Currently assigned minor number or -1 if LV is not active.Currently-in-use read ahead setting in current units.Set if LV has live table present.Set if LV has inactive table present.For snapshot, cache and thin pools and volumes, the percentage full if LV is active.For snapshots, the percentage full if LV is active.For cache and thin pools, the percentage of metadata full if LV is active.For Cache, RAID, mirrors and pvmove, current percentage in-sync.Cache settings/parameters as set in kernel, including default values (cached segments only).Cache metadata format used in kernel.For thin pools, how discards are handled in kernel.For thin pools and cache volumes, whether metadata check is needed.Set if snapshot LV is invalid.For vdo pools, its current operating mode.For vdo pools, whether compression is running.For vdo pools, state of index for deduplication.For vdo pools, currently used space.For vdo pools, percentage of saved space.Total writecache writeback blocks.Various attributes - see man page.Size of underlying device in current units.Free metadata area space on this device in current units.Size of smallest metadata area on this device in current units.Offset to the start of data on the underlying device.Total amount of unallocated space in current units.Total amount of allocated space in current units.Set if this device can be used for allocation.Set if this device is exported.Set if this device is missing in system.Total number of Physical Extents.Total number of allocated Physical Extents.Number of metadata areas on this device.Number of metadata areas in use on this device.Offset to the start of PV Bootloader Area on the underlying device in current units.Size of PV Bootloader Area in current units.Set if PV is an unchosen duplicate.Type of device ID such as WWID.Set if VG autoactivation is enabled.Total size of VG in current units.Total amount of free space in current units.System ID of the VG indicating which host owns it.Lock type of the VG used by lvmlockd.Lock args of the VG used by lvmlockd.Size of Physical Extents in current units.Total number of unallocated Physical Extents.Maximum number of LVs allowed in VG or 0 if unlimited.Maximum number of PVs allowed in VG or 0 if unlimited.Number of PVs in VG which are missing.Revision number of internal metadata. Incremented whenever it changes.Configuration profile attached to this VG.Number of metadata areas on this VG.Number of metadata areas in use on this VG.Free metadata area space for this VG in current units.Size of smallest metadata area for this VG in current units.Target number of in use metadata areas in the VG.Number of stripes or mirror/raid1 legs.Number of data stripes or mirror/raid1 legs.Size of out-of-place reshape space in current units.Size of out-of-place reshape space in logical extents.Data offset on each image device.New data offset after any reshape on each image device.Number of (rotating) parity chunks.For stripes, amount of data placed on one device before switching to the next.For mirrors/raids, the unit of data per leg when synchronizing devices.For snapshots, the unit of data used when tracking changes.For thin pools, the number of thin volumes in this pool.For thin pools, how discards are handled.For cache, metadata format in use.For cache, how writes are cached.For thin pools and volumes, if zeroing is enabled.For thin pools, the transaction id and creation transaction id for thins.For thin volume, the thin device id.Offset within the LV to the start of the segment in current units.Offset within the LV to the start of the segment in physical extents.Size of segment in current units.Size of segment in physical extents.Ranges of Physical Extents of underlying devices in command line format (deprecated, use seg_le_ranges for common format).Ranges of Logical Extents of underlying devices in command line format.Ranges of Logical Extents of underlying metadata devices in command line format.Underlying devices used with starting extent numbers.Underlying metadata devices used with starting extent numbers.Dmeventd monitoring status of the segment.The cache policy (cached segments only).Cache settings/parameters (cached segments only).Set for compressed LV (vdopool).Set for deduplicated LV (vdopool).Use REQ_SYNC for writes (vdopool).Minimum acceptable IO size (vdopool).Allocated caching size (vdopool).Speed of cache writes (vdopool).Allocated indexing memory (vdopool).Increment size for growing (vdopool).Acknowledging threads (vdopool).IO submitting threads (vdopool).CPU threads for compression and hashing (vdopool).Threads for subdivide parts (vdopool).Logical threads for subdivide parts (vdopool).Physical threads for subdivide parts (vdopool).Maximum discard size volume can recieve (vdopool).Specified write policy (vdopool).Header size at front of vdopool.Physical Extent number of start of segment.Logical Volume Device Info and Status CombinedReserved value for undefined numeric value.TELEBE.EqD^E[DDEE{D!E'*  ''''''''' !!" !##$ #%#&#' '( () )* *+,/)0)1)2)3)4)5)6)7)8)9):)unknownyesno10snapshot/snapshot.csnapshot-mergemerging_storecow_storesnapshot-origincow_store = "%s"merging_store = "%s"Couldn't read chunk size for snapshot.Merging store must be a string in segment %s of logical volume %s.Both snapshot cow and merging storage were specified in segment %s of logical volume %s.Cow store must be a string in segment %s of logical volume %s.Snapshot origin not specified in segment %s of logical volume %s.Snapshot origin must be a string in segment %s of logical volume %s.Unknown logical volume %s specified for snapshot cow store in segment %s of logical volume %s.Unknown logical volume %s specified for snapshot origin in segment %s of logical volume %s.Snapshot cow storage not specified in segment %s of logical volume %s.snapshot string list allocation failedTarget snapshot may leak metadata.striped/striped.c Stripes %u Stripe size %s Stripe size %u KB Stripe %d:# linearstripeInternal error: striped add_target_line called with no areas for %s.Couldn't read stripe_size for segment %s of logical volume %s.Couldn't find stripes array for segment %s of logical volume %s.Couldn't read 'stripe_count' for segment '%s'. Device ID %uthin/thin.cthin_pool Discards %s Thin count %u Transaction ID %lu Zero new blocks %sThin pool delete %u.Thin pool create_%s %s.thin_pool = "%s"transaction_id = %ludevice_id = %dexternal_origin = "%s"merge = "%s"discards = "%s"zero_new_blocks = 1crop_metadata = %umessage%d {create = "%s"delete = %ddiscards_non_power_2metadata_resizeexternal_origin_extendWARNING: LV %s maps %s while the size is only %s.Thin pool must be a string in segment %s of logical volume %s.Unknown thin pool %s in segment %s of logical volume %s.Could not read transaction_id for segment %s of logical volume %s.Origin must be a string in segment %s of logical volume %s.Unknown origin %s in segment %s of logical volume %s.Merge lv must be a string in segment %s of logical volume %s.Unknown merge lv %s in segment %s of logical volume %s.Could not read device_id for segment %s of logical volume %s.Unsupported value %u for device_id segment %s of logical volume %s.External origin must be a string in segment %s of logical volume %s.Unknown external origin %s in segment %s of logical volume %s.String list allocation failed for thin_pool.String list allocation failed for thin.WARNING: Ignoring invalid string in config file %s.Internal error: Segment %s has no pool.Failed to build uuid for pool LV %s.Internal error: Failed to add merged segment of %s.Thin target does not support smaller size of external origin LV %s.Failed to build uuid for external origin LV %s.Internal error: Thin pool is missing metadata device.Thin pool target does not support %s chunk size (needs kernel >= 3.6).Failed to build uuid for metadata LV %s.WARNING: Thin pool target does not support discards (needs kernel >= 3.4).WARNING: Thin pool target does not support error if no space (needs version >= 1.10).Internal error: Unsupported message.Thin pool set transaction id %lu.Metadata must be a string in segment %s of logical volume %s.Unknown metadata %s in segment %s of logical volume %s.Pool must be a string in segment %s of logical volume %s.Unknown pool %s in segment %s of logical volume %s.Could not read chunk_size segment %s of logical volume %s.Could not read discards for segment %s of logical volume %s.Discards option unsupported for segment %s of logical volume %s.Unsupported value %u for chunk_size segment %s of logical volume %s.Could not read zero_new_blocks for segment %s of logical volume %s.Could not read crop_metadata for segment %s of logical volume %s.Unknown LV %s for create message in segment %s of logical volume %s.Unknown message in segment %s of logical volume %s.Internal error: Invalid discards value %d.Internal error: Invalid zero new blocks value %d.Internal error: LV %s is not a thin volume.Internal error: Passed unsupported message.global/thin_disabled_featuresthinthin-poolUUID contains invalid character '%c'Couldn't write uuid, buffer too small.Too many characters to be uuid.Couldn't read uuid: incorrect number of characters.uuid/uuid.c0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ!#zero/zero.czero module string list allocation failedactivate/dev_manager.cLV percent: %s-cmetaRunning check command on %s-VbetteroldercryptostratisCRYPT-TEMPCRYPT-SUBDEVstratis-blocked_mirrors block_on_error%d:%d %d:%d%s: %s device %s not usable.invalid snapshotsfrozen raidfrozenunusable_thinsRemoving dm dev %u:%uPrelAdding new LV %s%s%s to dtree%*u:%*u %u%sblock/dm-%u/holdersFound holder %s of %s. origin-onlyCreating %s%s tree for %s.Deleting tracked UUID %s.dev_managerChecking device id for LV %s.V%u %*s %lu %*u %umissing_%d_%dFailed to set query_inactive_table.WARNING: Failed to disable open_count.WARNING: Failed to set no_flush.WARNING: Cannot find matching %s segment for %s.Internal error: WARNING: Segment type %s found does not match expected type %s for %s.Number of segments in active LV %s does not match metadata.Kernel driver has incomplete udev support so LVM will check and perform some operations itself.Failed to allocated path for callback.Internal error: Registering unsupported pool callback.Failed to build device path for checking cachevol metadata %s.Failed to build device path for checking pool metadata %s.Metadata checking skipped, detected empty disk header on %s.Internal error: Unable to find configuration for pool check options.Invalid string in config file: global/%s_check_options.Too many options for %s command.WARNING: Check is skipped, please install recommended missing binary %s!Found version of %s %s is %s then requested %u.%u.%u.WARNING: Cannot parse output '%s' from %s.WARNING: Check is skipped, please upgrade installed version of %s!Check of pool %s failed (status:%d). Manual repair required!WARNING: Integrity check of metadata for pool %s failed.Skipping checks for old devices without LVM- dm uuid prefix (kernel vsn %d >= %d).Getting device info for %s [%s].Failed to add device (%u:%u) to dtree.Tracking pending delete for %s %s (%s).Internal error: _emit_target cannot handle segment type %s.WARNING: Cannot get info from tree node for %s.%s: Empty device %s not usable.%s: Suspended device %s not usable.%s: Reserved uuid %s on internal LV device %s not usable.%s: Reserved internal LV device %s/%s%s%s not usable.%s: Reserved uuid %s on %s device %s not usable.%s: Scanning mirror devices is disabled.%s: Mirror image %d marked as failed.%s: Mirror log device marked as failed.%s: Mirror device %s not usable.WARNING: Incorrect snapshot table found for %d:%d.WARNING: Incorrect snapshot-origin table found for %d:%d.%s: Invalid %s device %s not usable.WARNING: %s frozen raid device (%d:%d) needs inspection.%s: Frozen %s device %s not usable.WARNING: Cannot get thin-pool major:minor for thin device %d:%d.WARNING: %s: Thin's thin-pool needs inspection.%s: Error device %s not usable.%s: I/O blocked to mirror device.Failed to set device number for remove %u:%uWARNING: Using linear target for %s/%s: Striped requires extent size (%u sectors) >= page size (%u)._add_new_lv_to_dtree: pool alloc failed for %s %s.Add cachevol %s to dtree before cache %s.Failed to add cachevol to dtree before cache.Using error for pending meta delete %s.Using error for pending data delete %s.%soaded thin volume %s with id %u is %smatching id %u.Merging of snapshot volume %s to origin %s is in progress.Postponing pending snapshot merge for origin %s, merge was not started before suspend.Postponing pending snapshot merge for origin %s, origin volume is opened.Postponing pending snapshot merge for origin volume %s, merging thin snapshot volume %s is active.Postponing pending snapshot merge for origin volume %s, merging snapshot volume %s is opened.Internal error: LV %s is not merging snapshot.Couldn't find snapshot for '%s'.Checking kernel supports %s segment type for %s%s%sCan't process LV %s: %s target support missing from kernel?Adding external origin LV %s and all active users.Finished adding external origin LV %s and all active users.Using error for pending delete %s.sysfs_path dm_snprintf failed.Failed to parse dm device minor number from %s.Checking holder of %s %s (%u:%u) %s.Cannot find holder with device name %s in VG %s.Volume %s (%u:%u) differs from already active device (%u:%u).The requested major:minor pair (%u:%u) is already used.Tracking pending delete for %s (%s).Internal error: Cannot create tree for %s.Partial dtree creation failed for %s.Lost dependency tree root node._clean_tree: Couldn't split up device name %s._clean_tree: Failed to duplicate uuid.Failed to remove all device symlinks associated with %s._create_lv_symlinks: Couldn't split up old device name %s._create_lv_symlinks: Couldn't split up new device name %s.Failed to create symlinks for %s.Getting device %s status percentage for %s.Checking raid status for volume %s.Expected %s segment type but got %s instead.Internal error: %s is not a RAID logical volume.Internal error: Unknown RAID message: %s.Internal error: %s is not a writecache logical volume.Checking status for cache volume %s.Checking thin pool status for LV %s.Checking thin status for LV %s.More then one table line found for %s.Unexpected target type %s found for thin %s.Cannot parse table like parameters %s for %s.Checking VDO pool status for LV %s.Checking VDO pool table line for LV %s.Failed to parse VDO parameters %s for LV %s.WARNING: Unknown VDO table line version %u.Aborting. LV %s is now incomplete and '--activationmode partial' was not specified.Internal error: Unassigned area found in LV %s.Cannot activate %s: pool incomplete.Internal error: _add_error_or_zero_device called with bad segment.Failed to create partial dtree.Failed to add device %s (%u:%u) to dtree.PRELOADACTIVATEDEACTIVATESUSPENDSUSPEND_WITH_LOCKFSCLEANactivate/fs.cRemoving link %s%s/groupCouldn't create path for %s.Removing %sLinking %s -> %ssymlinkCreating directory %smkdirRemoving directory %sSyncing device namesCouldn't determine link pathname.The link %s should have been removed by udev but it is still present. Falling back to direct link removal.%s not symbolic link - not removingCouldn't create destination pathname for logical volume link for %sCouldn't create pathname for LVM1 group file for %sNon-LVM1 character device found at %sSymbolic link %s not created: file existsSymlink %s that should have been created by udev does not have correct target. Falling back to direct link creationSymlink %s that should have been created by udev could not be checked for its correctness. Falling back to direct link creation.The link %s should have been created by udev but it was not found. Falling back to direct link creation.Couldn't create path for volume group dir %sCouldn't create source pathname for logical volume link %sCouldn't construct name of volume group directory.No space to stack fs operationreasonlvmpolld/lvmpolld-client.clvname = %svgname = %slvid = %scmdline = %sinterval = %sFailed to create %s request.abort = %ldhandle_missing_pvs = %ldsysdir = %sdevicesfile = %sOK abortprogress_infoin_progresssignalnot_foundlvmpolld failed to process a request. The reason was: %s.lvmpolld couldn't handle a request. It might be due to daemon internal state. The reason was: %s.Unexpected response %s. The reason: %s.For more information see lvmpolld messages in syslog or lvmpolld log file.Interval string conversion got truncated.Failed to process request with error %s (errno: %d).Sucessfully connected to lvmpolld on fd %d.WARNING: Failed to connect to lvmpolld. Proceeding with polling without using lvmpolld.WARNING: Check global/use_lvmpolld in lvm.conf or the lvmpolld daemon state.Internal error: Use of lvmpolld requires uuid setInternal error: Use of lvmpolld requires vgname setInternal error: Use of lvmpolld requires lvname setAsking lvmpolld for pvmove%s on %s/%s.Asking lvmpolld for mirror conversion on %s/%s.Asking lvmpolld for snapshot merge on %s/%s.Asking lvmpolld for thin snapshot merge on %s/%s.Internal error: Unsupported poll operation.Internal error: Unsupported poll operationInternal error: use of lvmpolld requires uuid being setAsking lvmpolld for progress status of an operation on %s/%s.Failed to create progress_info request.No polling operation in progress regarding LV %s.Command executed by lvmpolld got terminated by signal (%d).LVM command run by lvmpolld responded with: 'No such command.'LVM command run by lvmpolld failed due to invalid parameters.LVM command executed by lvmpolld failed.lvmpolld failed to duplicate file descriptors.lvmpolld failed to exec() lvm binary.lvmpolld responded with unexpected return code.Polling finished successfully.path_num = %ldFailed to create pvs request.locking/lvmlockd.cpath[%d] = %%sFailed to refresh %s.lockd_result reply error %dlockd_result bad responselockd_result no op_resultresult_flagsNO_LOCKSPACESNO_GL_LSNO_LMDUP_GL_LSWARN_GL_REMOVEDSH_EXISTSvg_name = %spid = %ldbusy_vgvg_lock_args = %svg_lock_type = %sfree_vginit_vgVG %s init failed: %dsanlock lvmlock LV removedFail to any PVs for VG %sVG %s find PV device %scmd = %slv_lock_args = %slv_uuid = %slv_name = %sopts = %smode = %slvmlockd %s %s result %d %xUnknown sector size %u.Failed to create internal lv./run/lvmlockd.pid/run/lvm/lvmlockd.socketfind_free_lockUnknown lock_type.start_initstart_vghost_id = %ldversion = %ldvg_uuid = %sVG %s starting %s lockspaceVG %s start failed: %dlockd stop VG %s lock_type %sstop_vgVG %s stop failed: %dstart_waitLock start failedlockd global lock_type %sUnknown lock-gl modelock_glRetrying %s global lockEnabling sanlock global lockGlobal lock failed: error %dlockd global mode %sGlobal lock failed: error %d.lockd VG %s mode %slock_vgRetrying %s lock on VG %sVG %s lock failed: removedVG %s lock skipped: error %dVG %s lock failed: error %dvg_updatelvextendlvresizelvchangelockd query LV %s/%squery_lock_lvLocking failed for LV %s/%sRefresh lvmlockNo vdo pool for %s/%sshupdatenorefresh/etc/mtabgfs2ocfs2%s/%s/%sinit_lvlv_lock_argslv_lock_args not returnedFailed to find vdo pool %s/%sFailed to lock vdo pool %s/%sfree_lv_free_lv lvmlockd result %drename_vg_finalrunning_lmlvmlockd found sanlocklvmlockd found dlmlvmlockd found idmFailed to unlock LV %s/%s.rename_vg_beforerefresh_lvpath = %sLV refresh failed for LV %sExtend sanlock LV from %llus (%llu bytes) to %us (%u bytes)Extend sanlock LV %s to size %s failed.Failed to refresh sanlock LV %s after extend.Extend sanlock LV %s name too long - extended size not zeroed.Extend sanlock LV zeroing %u bytes from offset %llu to %lluZeroing %u MiB on extended internal lvmlock LV...Extend sanlock LV %s cannot find device.Extend sanlock LV %s cannot open device.Extend sanlock LV %s cannot zero device at %lu.lockd_result %d flags %s lm %sLockspace for "%s" not stopped on other hosts%s: lock type %s lvmlockd result %dVG %s init failed: lvmlockd not availableVG %s init failed: invalid parameters for dlmVG %s init failed: lock manager %s is not runningVG %s init failed: lock manager %s is not supported by lvmlockdVG %s init failed: a lockspace with the same name existsVG %s init failed: lock_args not returnedVG %s init failed: lock_args alloc failedVG %s init failed: vg_write vg_commitFailed to deactivate sanlock lv %s/%sFailed to remove sanlock LV %s/%sFailed to activate sanlock lv %s/%sFail to allocate PV list for VG %sFail to allocate PV path for VG %slvmlockd %s %s vg %s lv %s result %d %xlvmlockd %s %s vg %s result %d %xlvmlockd %s %s failed no resultUsing sector size %u for sanlock LVCreating lvmlock LV for sanlock with size %um %ub %u extentsFailed to create sanlock lv %s in vg %sVG %s init failed: invalid parameters for sanlockVG %s init failed: sanlock cannot open device /dev/mapper/%s-%sCheck that sanlock has permission to access disks.VG %s init failed: lock manager sanlock is not runningVG %s init failed: lock manager sanlock is not supported by lvmlockdVG %s init failed: no disk space for leasesShould not initialize lvmlockd with use_lvmlockd=0.WARNING: lvmlockd socket location is not configured.WARNING: lvmlockd process is not running.Should not connect to lvmlockd with use_lvmlockd=0.lvmlockd is already connected.Successfully connected to lvmlockd on fd %d.WARNING: lvmlockd connect failed.VG %s start failed: lvmlockd is not enabledVG %s start failed: lvmlockd is not runninglockd start VG %s lock_type %s init %dVG %s start failed: lvmlockd not availableVG %s start error: already startedVG %s start error: already startingVG %s start failed: invalid parameters for %sVG %s start failed: invalid sanlock host_id, set in lvmlocal.confVG %s start failed: lock manager %s is not runningVG %s start failed: lock manager %s is not supported by lvmlockdVG %s stop failed: LVs must first be deactivatedlockd_stop_vg deactivate sanlock lvMissing global lock: global lock was lost by removing a previous VG.To enable the global lock in another VG, see lvmlockctl --gl-enable.Cannot create VG with lock_type %s without lvmlockd.Global lock failed: check that lvmlockd is running.Global lock failed: start existing sanlock VGs to access global lock.(If all sanlock VGs are started, enable global lock with lvmlockctl.)Global lock failed: check that VG holding global lock exists and is started.Global lock failed: check that global lockspace is started.Start a lock manager, lvmlockd did not find one running.Global lock failed: lockspace is starting.Global lock failed: held by other host.VG create failed: lock manager %s is not supported by lvmlockd.Exclusive locks are not allowed with readonly option.Unknown lvmlockd global lock modeReading without shared global lock.lockd global mode %s already held.Global lock failed: lockspace is startingGlobal lock failed: check that global lockspace is startedGlobal lock failed: storage errors for sanlock leasesGlobal lock failed: storage failed for sanlock leasesSkipping global lock: lockspace is startingSkipping global lock: storage %s for sanlock leasesSkipping global lock: VG with global lock was removedSkipping global lock: lockspace not found or startedDuplicate sanlock global locks should be correctedVG %s lock skipped: lock start in progressVG %s lock failed: lock start in progressVG %s lock skipped: storage %s for sanlock leasesVG %s lock failed: storage %s for sanlock leasesVG %s lock skipped: held by other host.VG %s lock failed: held by other host.Duplicate sanlock global lock in VG %sLV locks are not allowed with readonly option.Lock query failed for LV %s/%squery_lock_lv lvmlockd result %dquery_lock_lv mode not returnedWARNING: shared LV may require refresh on other hosts where it is active.Shared activation not compatible with LV type %s of %s/%slockd LV %s/%s mode %s uuid %sFail to find any PVs for %s/%s, try to find PVs from VG insteadFail to allocate PV list for %s/%sFail to allocate PV path for LV %s/%sFind PV device %s for LV %s/%sLV locked by other host: %s/%sWARNING: extending LV with a shared lock, other hosts may require LV refresh.LV is already locked with incompatible mode: %s/%sLV %s/%s lock failed: lockspace is inactiveLV %s/%s lock failed: storage %s for sanlock leasesLV %s/%s lock failed: error %dLV in VG %s with lock_type %s requires lvmlockd.Cannot find thin pool for %s/%sLock on incorrect thin lv type %s/%sLock on incorrect vdo lv type %s/%sLV path too long for lvmlockd refresh.Lock already exists for LV %s/%sNo sanlock space for lock for LV %s/%s_init_lv_sanlock lvmlockd result %dlv_lock_args allocation failedlockd_init_lv: unknown lock_type.Cannot create snapshot without origin LV in shared VG.Failed to find origin LV %s/%sFailed to lock origin LV %s/%sFailed to find thin pool %s/%sFailed to lock thin pool %s/%sCreate thin pool and thin LV separately with lock type %sUnknown thin options for lock init.lockd_free_lv: unknown lock_type.Failed to restart VG %s lockspace.lockd_rename_vg_final lvmlockd result %dFailed to start VG %s lockspace.Failed to get result from lvmlockdFailed to find a running lock manager.LV %s/%s must be inactive on all hosts.Cannot change VG %s with active LVsGlobal lock failed: global lock was lost by removing a previous VG._free_vg_sanlock %s no lock_args_free_vg_sanlock lvmlockd result %dVG %s held the sanlock global lock, enable global lock in another VG.LVs must be inactive before vgrename.Cannot rename VG %s with active LVslockd_rename_vg_before lvmlockd result %dlockd_rename_vg_before deactivate sanlock lvRefreshing LV %s on other hosts...Failed to refresh LV on all hosts.Manual lvchange --refresh required on all hosts for %s. } }H}0}p}~~}~}88_free_vg_busy_vgvdo/vdo.cvdo_poolvdo_offset Virtual size %s Header size %sCompression %s %sDeduplicationMetadata hints Minimum IO size %s Block map cache sz %s Block map era length %uSparse index Index memory size %s Slab size %s # Ack threads %u # Bio threads %u Bio rotation %u # CPU threads %u # Hash zone threads %u # Logical threads %u # Physical threads %u Max discard %u Write policy %sonline_renameversion4Unknown logical volume %s.vdo_pool = "%s"vdo_offset = %uheader_size = %uvirtual_extents = %uuse_compression = 1use_deduplication = 1use_metadata_hints = 1minimum_io_size = %ublock_map_cache_size_mb = %ublock_map_era_length = %uuse_sparse_index = 1index_memory_size_mb = %umax_discard = %uslab_size_mb = %uack_threads = %ubio_threads = %ubio_rotation = %ucpu_threads = %uhash_zone_threads = %ulogical_threads = %uphysical_threads = %uwrite_policy = %sInitialised segtypes: %s, %s.Internal error: Passed segment is not VDO pool.Couldn't read '%s' for VDO segment.Unknown VDO pool logical volume %s.String list allocation failed for VDO module.WARNING: Target %s version %u.%u.%u is too old.Target %s %s support disabled by %s.Internal error: Passed segment is not VDO type.Failed to allocate memory for VDO segtypes.global/vdo_disabled_featureskvdo ...command.cTagSelectDESC: %s _long--uuidstr prev OO:OO_OP:Cannot find command %s.lvreduceOO_ALL:AUTOTYPE:FLAGS:SECONDARY_SYNTAXPREVIOUS_SYNTAXRULE:Parsing command defs: no mem.LV_lv_is_ID:Failer to duplicate name %s.Failer to duplicate line %s.IO:OO_ALL -%c|%s (, %c%c [ --type %s ] (implied)[ --type %s|%s ] (implied) [ -l|--extents [ COMMON_OPTIONS ] [ Common options for lvm: Common options for command:devtypesdumpconfigformatsfullreportDisplay full reportDisplay help for commandslastlogChange logical volume layoutCreate a logical volumelvdisplayAdd space to a logical volumelvmchangelvmconfiglvmdevicesManage the devices filelvmdiskscanlvmsadcCollect activity datalvmsarCreate activity reportlvpolllvrenameRename a logical volumeResize a logical volumelvscanpvchangepvckpvdatapvdisplaypvremovepvresizeResize physical volume(s)pvscanList all physical volumessegtypesList available segment typesvgcfgbackupvgcfgrestorevgchangevgckvgconvertCreate a volume groupvgdisplayvgexportvgextendvgimportvgimportcloneImport a VG from cloned PVsvgimportdevicesvgmergeMerge volume groupsvgmknodesvgreduceRemove volume group(s)vgrenameRename a volume groupvgsvgscanSearch for all volume groupsvgsplitCMD_NONEdevtypes_general_CMDdevtypes_generalformats_general_CMDformats_generalfullreport_general_CMDfullreport_generalhelp_general_CMDhelp_generallastlog_general_CMDlastlog_generallvchange_activate_CMDlvchange_activatelvchange_monitor_CMDlvchange_monitorlvchange_persistent_CMDlvchange_persistentlvchange_poll_CMDlvchange_polllvchange_properties_CMDlvchange_propertieslvchange_rebuild_CMDlvchange_rebuildlvchange_refresh_CMDlvchange_refreshlvchange_resync_CMDlvchange_resynclvchange_syncaction_CMDlvchange_syncactionlvconvert_change_mirrorloglvconvert_change_region_sizelvconvert_integrity_CMDlvconvert_integritylvconvert_merge_CMDlvconvert_mergelvconvert_merge_mirror_imageslvconvert_merge_snapshot_CMDlvconvert_merge_snapshotlvconvert_merge_thin_CMDlvconvert_merge_thinlvconvert_plain_CMDlvconvert_plainlvconvert_raid_types_CMDlvconvert_raid_typeslvconvert_repair_CMDlvconvert_repairlvconvert_replace_pv_CMDlvconvert_replace_pvlvconvert_split_cow_snapshotlvconvert_split_mirror_imageslvconvert_start_poll_CMDlvconvert_start_polllvconvert_swap_pool_metadatalvconvert_to_cachepool_CMDlvconvert_to_cachepoollvconvert_to_thinpool_CMDlvconvert_to_thinpoollvconvert_to_vdopool_CMDlvconvert_to_vdopoollvconvert_to_vdopool_paramlvconvert_to_writecache_CMDlvconvert_to_writecachelvcreate_and_attach_cachepoollvcreate_cachepool_CMDlvcreate_cachepoollvcreate_cow_snapshot_CMDlvcreate_cow_snapshotlvcreate_error_vol_CMDlvcreate_error_vollvcreate_linear_CMDlvcreate_linearlvcreate_mirror_CMDlvcreate_mirrorlvcreate_mirror_or_raid1_CMDlvcreate_mirror_or_raid1lvcreate_raid_any_CMDlvcreate_raid_anylvcreate_striped_CMDlvcreate_stripedlvcreate_thin_snapshot_CMDlvcreate_thin_snapshotlvcreate_thin_vol_CMDlvcreate_thin_vollvcreate_thinpool_CMDlvcreate_thinpoollvcreate_vdo_vol_CMDlvcreate_vdo_vollvcreate_zero_vol_CMDlvcreate_zero_vollvdisplay_general_CMDlvdisplay_generallvextend_by_policy_CMDlvextend_by_policylvextend_by_pv_CMDlvextend_by_pvlvextend_by_size_CMDlvextend_by_sizelvmchange_general_CMDlvmchange_generallvmconfig_general_CMDlvmconfig_generallvmdevices_check_CMDlvmdevices_checklvmdevices_edit_CMDlvmdevices_editlvmdevices_list_CMDlvmdevices_listlvmdevices_update_CMDlvmdevices_updatelvmdiskscan_general_CMDlvmdiskscan_generallvmsadc_general_CMDlvmsadc_generallvmsar_general_CMDlvmsar_generallvpoll_general_CMDlvpoll_generallvreduce_general_CMDlvreduce_generallvremove_general_CMDlvremove_generallvrename_lv_lv_CMDlvrename_lv_lvlvrename_vg_lv_lv_CMDlvrename_vg_lv_lvlvresize_by_pv_CMDlvresize_by_pvlvresize_by_size_CMDlvresize_by_sizelvs_general_CMDlvs_generallvscan_general_CMDlvscan_generalpvchange_properties_all_CMDpvchange_properties_allpvchange_properties_some_CMDpvchange_properties_somepvck_dump_CMDpvck_dumppvck_general_CMDpvck_generalpvck_repair_CMDpvck_repairpvck_repair_type_CMDpvck_repair_typepvcreate_general_CMDpvcreate_generalpvdata_general_CMDpvdata_generalpvdisplay_general_CMDpvdisplay_generalpvmove_any_CMDpvmove_anypvmove_one_CMDpvmove_onepvremove_general_CMDpvremove_generalpvresize_general_CMDpvresize_generalpvs_general_CMDpvs_generalpvscan_cache_CMDpvscan_cachepvscan_display_CMDpvscan_displaysegtypes_general_CMDsegtypes_generalsystemid_general_CMDsystemid_generaltags_general_CMDtags_generalversion_general_CMDversion_generalvgcfgbackup_general_CMDvgcfgbackup_generalvgcfgrestore_by_file_CMDvgcfgrestore_by_filevgcfgrestore_by_vg_CMDvgcfgrestore_by_vgvgcfgrestore_list_by_file_CMDvgcfgrestore_list_by_filevgcfgrestore_list_by_vg_CMDvgcfgrestore_list_by_vgvgchange_activate_CMDvgchange_activatevgchange_lockstart_CMDvgchange_lockstartvgchange_lockstop_CMDvgchange_lockstopvgchange_locktype_CMDvgchange_locktypevgchange_monitor_CMDvgchange_monitorvgchange_poll_CMDvgchange_pollvgchange_properties_CMDvgchange_propertiesvgchange_refresh_CMDvgchange_refreshvgchange_systemid_CMDvgchange_systemidvgck_general_CMDvgck_generalvgck_update_metadata_CMDvgck_update_metadatavgconvert_general_CMDvgconvert_generalvgcreate_general_CMDvgcreate_generalvgdisplay_general_CMDvgdisplay_generalvgexport_all_CMDvgexport_allvgexport_some_CMDvgexport_somevgextend_general_CMDvgextend_generalvgimport_all_CMDvgimport_allvgimport_some_CMDvgimport_somevgimportclone_general_CMDvgimportclone_generalvgimportdevices_all_CMDvgimportdevices_allvgimportdevices_some_CMDvgimportdevices_somevgmerge_general_CMDvgmerge_generalvgmknodes_general_CMDvgmknodes_generalvgreduce_all_CMDvgreduce_allvgreduce_by_pv_CMDvgreduce_by_pvvgreduce_missing_CMDvgreduce_missingvgremove_general_CMDvgremove_generalvgrename_by_name_CMDvgrename_by_namevgrename_by_uuid_CMDvgrename_by_uuidvgs_general_CMDvgs_generalvgscan_general_CMDvgscan_generalvgsplit_by_lv_CMDvgsplit_by_lvvgsplit_by_pv_CMDvgsplit_by_pvCMD_COUNTLVT_NONElinear_LVTstriped_LVTsnapshot_LVTthin_LVTthinpool_LVTcachepool_LVTvdo_LVTvdopool_LVTvdopooldata_LVTvdopooldatamirror_LVTraid_LVTraid0_LVTraid1_LVTraid4_LVTraid5_LVTraid6_LVTraid10_LVTerror_LVTzero_LVTwritecache_LVTintegrity_LVTLVT_COUNTLVP_NONEis_locked_LVPlv_is_lockedis_partial_LVPlv_is_partialis_virtual_LVPlv_is_virtualis_merging_LVPlv_is_mergingis_merging_origin_LVPlv_is_merging_originis_converting_LVPlv_is_convertingis_external_origin_LVPlv_is_external_originis_virtual_origin_LVPlv_is_virtual_originis_not_synced_LVPlv_is_not_syncedis_pending_delete_LVPlv_is_pending_deleteis_error_when_full_LVPlv_is_error_when_fullis_pvmove_LVPlv_is_pvmoveis_removed_LVPlv_is_removedis_vg_writable_LVPlv_is_vg_writableis_thinpool_data_LVPlv_is_thinpool_datais_thinpool_metadata_LVPlv_is_thinpool_metadatais_cachepool_data_LVPlv_is_cachepool_datais_cachepool_metadata_LVPlv_is_cachepool_metadatais_mirror_image_LVPlv_is_mirror_imageis_mirror_log_LVPlv_is_mirror_logis_raid_image_LVPlv_is_raid_imageis_raid_metadata_LVPlv_is_raid_metadatais_origin_LVPlv_is_originis_thick_origin_LVPlv_is_thick_originis_thick_snapshot_LVPlv_is_thick_snapshotis_thin_origin_LVPlv_is_thin_originis_thin_snapshot_LVPlv_is_thin_snapshotis_cache_origin_LVPlv_is_cache_originis_merging_cow_LVPlv_is_merging_cowis_cow_covering_origin_LVPlv_is_cow_covering_originis_visible_LVPlv_is_visibleis_historical_LVPlv_is_historicalis_raid_with_tracking_LVPlv_is_raid_with_trackingis_raid_with_integrity_LVPlv_is_raid_with_integrityLVP_COUNTARG_UNUSEDabort_ARG--abortactivationmode_ARG--activationmodeaddtag_ARG--addtagadddev_ARG--adddevdeldev_ARG--deldevaddpvid_ARG--addpviddelpvid_ARG--delpvidaligned_ARG--alignedalloc_ARG--allocatomic_ARG--atomicatversion_ARG--atversionsetautoactivation_ARG--setautoactivationbinary_ARG--binarybootloaderareasize_ARG--bootloaderareasizecache_long_ARG--cachecachemetadataformat_ARG--cachemetadataformatcachemode_ARG--cachemodecachepool_ARG--cachepoolThe name of a cache pool. cachevol_ARG--cachevolThe name of a cache volume. cachedevice_ARG--cachedevicecachesize_ARG--cachesizeThe size of cache to use. check_ARG--checkcommandprofile_ARG--commandprofilecompression_ARG--compression--configconfigreport_ARG--configreportSee \fBlvmreport\fP(7). configtype_ARG--typeconfigdataalignment_ARG--dataalignmentdataalignmentoffset_ARG--dataalignmentoffsetdeduplication_ARG--deduplicationdeltag_ARG--deltagdetachprofile_ARG--detachprofiledeviceidtype_ARG--deviceidtype--devicesdevicesfile_ARG--devicesfilediscards_ARG--discardsdriverloaded_ARG--driverloadeddump_ARG--dumperrorwhenfull_ARG--errorwhenfullforce_long_ARGforeign_ARG--foreignhandlemissingpvs_ARG--handlemissingpvsignoreadvanced_ARG--ignoreadvancedignorelocal_ARG--ignorelocalignorelockingfailure_ARG--ignorelockingfailureignoremonitoring_ARG--ignoremonitoringignoreskippedcluster_ARG--ignoreskippedclusterNo longer used. ignoreunsupported_ARG--ignoreunsupportedimportdevices_ARG--importdevicesjournal_ARG--journallabelsector_ARG--labelsectorlistlvs_ARG--listlvslistvg_ARG--listvgcheckcomplete_ARG--checkcompletelockopt_ARG--lockoptlockstart_ARG--lockstartlockstop_ARG--lockstoplocktype_ARG--locktypelogonly_ARG--logonlylonghelp_ARG--longhelpDisplay long help text. --maxrecoveryratemerge_ARG--mergemergemirrors_ARG--mergemirrorsmergesnapshot_ARG--mergesnapshotmergethin_ARG--mergethinmergedconfig_ARG--mergedconfigmetadataignore_ARG--metadataignoremetadataprofile_ARG--metadataprofile--metadatasizeminor_ARG--minor--minrecoveryratemirrorlog_ARG--mirrorlogmirrorsonly_ARG--mirrorsonlymknodes_ARG--mknodesmonitor_ARG--monitornameprefixes_ARG--nameprefixesnoheadings_ARG--noheadingsnohints_ARG--nohintsnohistory_ARG--nohistorynolocking_ARG--nolockingDisable locking. norestorefile_ARG--norestorefilenosuffix_ARG--nosuffixnosync_ARG--nosyncnotifydbus_ARG--notifydbusnoudevsync_ARG--noudevsyncoriginname_ARG--originnamesetphysicalvolumesize_ARG--setphysicalvolumesize--settings--pollpolloperation_ARG--polloperationpooldatasize_ARG--pooldatasizepoolmetadata_ARG--poolmetadatapoolmetadatasize_ARG--poolmetadatasizepoolmetadataspare_ARG--poolmetadataspare--profilepvmetadatacopies_ARG--pvmetadatacopiesraidintegrity_ARG--raidintegrityraidintegrityblocksize_ARG--raidintegrityblocksizeraidintegritymode_ARG--raidintegritymodereadonly_ARG--readonlyrefresh_ARG--refreshremovemissing_ARG--removemissing--rebuildrepair_ARG--repairrepairtype_ARG--repairtypereplace_ARG--replacereportformat_ARG--reportformat--restorefilerestoremissing_ARG--restoremissingresync_ARG--resyncrows_ARG--rowsOutput columns as rows. segments_ARG--segmentsseparator_ARG--separatorshared_ARG--sharedsinceversion_ARG--sinceversionsplitcache_ARG--splitcachesplitmirrors_ARG--splitmirrorssplitsnapshot_ARG--splitsnapshotshowdeprecated_ARG--showdeprecatedshowunsupported_ARG--showunsupportedstartpoll_ARG--startpollstripes_long_ARGswapmetadata_ARG--swapmetadata--syncactionsysinit_ARG--sysinitsystemid_ARG--systemidthinpool_ARG--thinpoolThe name of a thin pool LV. trackchanges_ARG--trackchangestrustcache_ARG--trustcache--typeudevoutput_ARG--udevoutputunbuffered_ARG--unbuffereduncache_ARG--uncacheupdate_ARG--updatecachepolicy_ARG--cachepolicycachesettings_ARG--cachesettingsunconfigured_ARG--unconfiguredunits_ARG--unitsunquoted_ARG--unquotedusepolicies_ARG--usepoliciesvalidate_ARG--validatevdo_ARG--vdovdopool_ARG--vdopoolvdosettings_ARG--vdosettings--versionDisplay version information. vgmetadatacopies_ARG--vgmetadatacopiesvgonline_ARG--vgonlinewithsummary_ARG--withsummarywithcomments_ARG--withcommentswithgeneralpreamble_ARG--withgeneralpreamblewithlocalpreamble_ARG--withlocalpreamblewithspaces_ARG--withspaceswithversions_ARG--withversions--writebehind--writemostlycorelog_ARG--corelogresizable_ARG--resizableallocation_ARG--allocationavailable_ARG--availableraidrebuild_ARG--raidrebuildraidsyncaction_ARG--raidsyncactionraidwritemostly_ARG--raidwritemostlyraidminrecoveryrate_ARG--raidminrecoveryrateraidmaxrecoveryrate_ARG--raidmaxrecoveryrateraidwritebehind_ARG--raidwritebehindvirtualoriginsize_ARG--virtualoriginsizesplit_ARG--split--metadatacopiesactivate_ARG--activateall_ARG--allautobackup_ARG--autobackupactivevolumegroups_ARG--activevolumegroupsbackground_ARG--backgroundbasevgname_ARG--basevgnameblockdevice_ARG--blockdevicechunksize_ARG--chunksizeclustered_ARG--clusteredcolon_ARG--coloncolumns_ARG--columnscontiguous_ARG--contiguousdebug_ARG--debugexported_ARG--exportedphysicalextent_ARG--physicalextent--fileforce_ARG--full--helpDisplay help text. --historyhelp2_ARGimport_ARG--importinterval_ARG--intervaliop_version_ARG--iop_versionstripes_ARGstripesize_ARGlogicalvolume_ARG--logicalvolumemaxlogicalvolumes_ARG--maxlogicalvolumesextents_ARG--extents--listlvmpartition_ARG--lvmpartitionOnly report PVs. --sizepersistent_ARG--persistentmajor_ARG--majorsetactivationskip_ARG--setactivationskipignoreactivationskip_ARG--ignoreactivationskipmaps_ARG--maps--mirrorsmetadatatype_ARG--metadatatype--namenofsck_ARG--nofscknovolumegroup_ARG--novolumegroupoldpath_ARG--oldpathoptions_ARG--optionssort_ARG--sortmaxphysicalvolumes_ARG--maxphysicalvolumespermission_ARG--permissionpartial_ARG--partialphysicalvolume_ARG--physicalvolumequiet_ARG--quietreadahead_ARG--readaheadresizefs_ARG--resizefsreset_ARG--resetregionsize_ARGphysicalextentsize_ARG--physicalextentsize--snapshotshort_ARG--shortstdin_ARG--stdinselect_ARG--selecttest_ARG--test--thinupdatemetadata_ARG--updatemetadatauuid_ARG--uuiduuidstr_ARGuuidlist_ARG--uuidlistverbose_ARG--volumegroupvirtualsize_ARG--virtualsizewipesignatures_ARG--wipesignaturesallocatable_ARG--allocatableresizeable_ARG--resizeableyes_ARGzero_ARG--zeroARG_COUNTnone_VALERRconststr_VALConstStringconstnum_VALConstNumberbool_VALBooly|nsnumber_VALSNumber[+|-]Numberpnumber_VALPNumber[+]Numberuint32_VALUint32string_VALvg_VALlv_VALpv_VALtag_VALselect_VALactivationmode_VALActivationModepartial|degraded|completeactivation_VALActivey|n|aycachemetadataformat_VALCacheMetadataFormatauto|1|2cachemode_VALCacheModediscards_VALDiscardspassdown|nopassdown|ignoremirrorlog_VALMirrorLogcore|diskssizekb_VALSSizeKB[+|-]Size[k|UNIT]ssizemb_VALSSizeMB[+|-]Size[m|UNIT]psizemb_VALPSizeMB[+]Size[m|UNIT]NSizeMB[-]Size[m|UNIT]regionsizemb_VALRegionSizesextents_VALSExtents[+|-]Number[PERCENT]pextents_VALPExtents[+]Number[PERCENT]nextents_VALNExtents[-]Number[PERCENT]permission_VALPermissionrw|rmetadatatype_VALMetadataTypeunits_VALUnitssegtype_VALSegTypealloc_VALAlloclocktype_VALLockTypesanlock|dlm|nonereadahead_VALReadaheadauto|none|Numbervgmetadatacopies_VALMetadataCopiesVGall|unmanaged|Numberpvmetadatacopies_VALMetadataCopiesPV0|1|2unusedpolloperation_VALPollOpwritemostly_VALWriteMostlyPVPV[:t|n|y]syncaction_VALSyncActioncheck|repairreportformat_VALReportFmtbasic|jsonconfigreport_VALConfigReportlog|vg|lv|pv|pvseg|segconfigtype_VALConfigTyperepairtype_VALRepairTypedumptype_VALDumpTypeVAL_COUNTParsing command defs: options must be specified in long form: %s.Parsing command defs: unknown lv type %s.Parsing command defs: unknown pos arg: %s.Parsing command defs: unknown opt str: "%s"%s%s.Parsing command defs: unknown opt arg: %s.Parsing command defs: option %s must be followed by an arg.Parsing command defs: can't parse argc %d argv %s%s%s.Parsing command defs: no OO line found for %s.File cmds.h has unsorted name entry %s.File commands.h has unsorted name entry %s.Parsing command defs: too many rules for cmd.Parsing command defs: unknown lv property %s.Parsing command defs: invalid OO definition.Parsing command defs: no memory.Parsing command defs: can't process input line %s. Special options for command: [ --extents Number[PERCENT] ] The --extents option can be used in place of --size. The number allows an optional percent suffix. [ --name String ] The --name option is not required but is typically used. When a name is not specified, a new LV name is generated with the "lvol" prefix and a unique numeric suffix. Common variables for lvm: Variables in option or position args are capitalized, e.g. PV, VG, LV, Size, Number, String, Tag. PV Physical Volume name, a device path under /dev. For commands managing physical extents, a PV positional arg generally accepts a suffix indicating a range (or multiple ranges) of PEs. When the first PE is omitted, it defaults to the start of the device, and when the last PE is omitted it defaults to the end. PV[:PE-PE]... is start and end range (inclusive), PV[:PE+PE]... is start and length range (counting from 0). LV Logical Volume name. See lvm(8) for valid names. An LV positional arg generally includes the VG name and LV name, e.g. VG/LV. LV followed by _ indicates that an LV of the given type is required. (raid represents raid type). The _new suffix indicates that the LV name is new. Tag Tag name. See lvm(8) for information about tag names and using tags in place of a VG, LV or PV. Select Select indicates that a required positional arg can be omitted if the --select option is used. No arg appears in this position. Size[UNIT] Size is an input number that accepts an optional unit. Input units are always treated as base two values, regardless of capitalization, e.g. 'k' and 'K' both refer to 1024. The default input unit is specified by letter, followed by |UNIT. UNIT represents other possible input units: BbBsSkKmMgGtTpPeE. (This should not be confused with the output control --units, where capital letters mean multiple of 1000.)Display and manipulate configuration informationDisplay recognised built-in block device typesList available metadata formatsDisplay last command's log reportChange the attributes of logical volume(s)Display information about a logical volumeWith the device mapper, this is obsolete and does nothing.List devices that may be used as physical volumesContinue already initiated poll operation on a logical volumeReduce the size of a logical volumeRemove logical volume(s) from the systemDisplay information about logical volumesList all logical volumes in all volume groupsChange attributes of physical volume(s)Check metadata on physical volumesInitialize physical volume(s) for use by LVMDisplay the on-disk metadata for physical volume(s)Display various attributes of physical volume(s)Move extents from one physical volume to anotherRemove LVM label(s) from physical volume(s)Display information about physical volumesDisplay the system ID, if any, currently set on this hostList tags defined on this hostDisplay software and driver version informationBackup volume group configuration(s)Restore volume group configurationChange volume group attributesCheck the consistency of volume group(s)Change volume group metadata formatDisplay volume group informationUnregister volume group(s) from the systemAdd physical volumes to a volume groupRegister exported volume group with systemAdd devices for a VG to the devices file.Create the special files for volume group devices in /devRemove physical volume(s) from a volume groupDisplay information about volume groupsMove physical volumes into a new or existing volume grouplvconvert_change_mirrorlog_CMDlvconvert_change_region_size_CMDlvconvert_combine_split_snapshot_CMDlvconvert_combine_split_snapshotlvconvert_merge_mirror_images_CMDlvconvert_split_and_keep_cache_CMDlvconvert_split_and_keep_cachelvconvert_split_and_remove_cache_CMDlvconvert_split_and_remove_cachelvconvert_split_cow_snapshot_CMDlvconvert_split_mirror_images_CMDlvconvert_swap_pool_metadata_CMDlvconvert_to_cache_with_cachepool_CMDlvconvert_to_cache_with_cachepoollvconvert_to_cache_with_cachevol_CMDlvconvert_to_cache_with_cachevollvconvert_to_cache_with_device_CMDlvconvert_to_cache_with_devicelvconvert_to_cachepool_or_swap_metadata_CMDlvconvert_to_cachepool_or_swap_metadatalvconvert_to_thin_with_external_CMDlvconvert_to_thin_with_externallvconvert_to_thinpool_or_swap_metadata_CMDlvconvert_to_thinpool_or_swap_metadatalvconvert_to_vdopool_param_CMDlvconvert_to_writecache_with_device_CMDlvconvert_to_writecache_with_devicelvcreate_and_attach_cachedevice_for_cache_CMDlvcreate_and_attach_cachedevice_for_cachelvcreate_and_attach_cachedevice_for_writecache_CMDlvcreate_and_attach_cachedevice_for_writecachelvcreate_and_attach_cachepool_CMDlvcreate_and_attach_cachepool_v2_CMDlvcreate_and_attach_cachepool_v2lvcreate_and_attach_cachepool_v3_CMDlvcreate_and_attach_cachepool_v3lvcreate_and_attach_cachevol_for_cache_CMDlvcreate_and_attach_cachevol_for_cachelvcreate_and_attach_cachevol_for_writecache_CMDlvcreate_and_attach_cachevol_for_writecachelvcreate_cow_snapshot_with_virtual_origin_CMDlvcreate_cow_snapshot_with_virtual_originlvcreate_new_plus_old_cachepool_or_lvconvert_old_plus_new_cachepool_CMDlvcreate_new_plus_old_cachepool_or_lvconvert_old_plus_new_cachepoollvcreate_thin_snapshot_of_external_CMDlvcreate_thin_snapshot_of_externallvcreate_thin_vol_and_thinpool_CMDlvcreate_thin_vol_and_thinpoollvcreate_thin_vol_with_thinpool_or_sparse_snapshot_CMDlvcreate_thin_vol_with_thinpool_or_sparse_snapshotlvextend_pool_metadata_by_size_CMDlvextend_pool_metadata_by_sizelvresize_pool_metadata_by_size_CMDlvresize_pool_metadata_by_size#pvmove Abort any pvmove operations in progress. If a pvmove was started with the --atomic option, then all LVs will remain on the source PV. Otherwise, segments that have been moved will remain on the destination PV, while unmoved segments will remain on the source PV. #lvpoll Stop processing a poll operation in lvmpolld. Determines if LV activation is allowed when PVs are missing, e.g. because of a device failure. \fBcomplete\fP only allows LVs with no missing PVs to be activated, and is the most restrictive mode. \fBdegraded\fP allows RAID LVs with missing PVs to be activated. (This does not include the "mirror" type, see "raid1" instead.) \fBpartial\fP allows any LV with missing PVs to be activated, and should only be used for recovery or repair. For default, see \fBlvm.conf\fP(5) activation_mode. See \fBlvmraid\fP(7) for more information. Adds a tag to a PV, VG or LV. This option can be repeated to add multiple tags at once. See \fBlvm\fP(8) for information about tags. Add a device to the devices file. Remove a device from the devices file. Find a device with the PVID and add the device to the devices file. Remove a device with the PVID from the devices file. Use with --separator to align the output columns Determines the allocation policy when a command needs to allocate Physical Extents (PEs) from the VG. Each VG and LV has an allocation policy which can be changed with vgchange/lvchange, or overridden on the command line. \fBnormal\fP applies common sense rules such as not placing parallel stripes on the same PV. \fBinherit\fP applies the VG policy to an LV. \fBcontiguous\fP requires new PEs be placed adjacent to existing PEs. \fBcling\fP places new PEs on the same PV as existing PEs in the same stripe of the LV. If there are sufficient PEs for an allocation, but normal does not use them, \fBanywhere\fP will use them even if it reduces performance, e.g. by placing two stripes on the same PV. Optional positional PV args on the command line can also be used to limit which PVs the command will use for allocation. See \fBlvm\fP(8) for more information about allocation. Makes a pvmove operation atomic, ensuring that all affected LVs are moved to the destination PV, or none are if the operation is aborted. Specify an LVM version in x.y.z format where x is the major version, the y is the minor version and z is the patchlevel (e.g. 2.2.106). When configuration is displayed, the configuration settings recognized at this LVM version will be considered only. This can be used to display a configuration that a certain LVM version understands and which does not contain any newer settings for which LVM would issue a warning message when checking the configuration. Set the autoactivation property on a VG or LV. Display the property with vgs or lvs "-o autoactivation". When the autoactivation property is disabled, the VG or LV will not be activated by a command doing autoactivation (vgchange, lvchange, or pvscan using -aay.) If autoactivation is disabled on a VG, no LVs will be autoactivated in that VG, and the LV autoactivation property has no effect. If autoactivation is enabled on a VG, autoactivation can be disabled for individual LVs. Use binary values "0" or "1" instead of descriptive literal values for columns that have exactly two valid values to report (not counting the "unknown" value which denotes that the value could not be determined). Reserve space for the bootloader between the LVM metadata area and the first PE. The bootloader area is reserved for bootloaders to embed their own data or metadata; LVM will not use it. The bootloader area begins where the first PE would otherwise be located. The first PE is moved out by the size of the bootloader area, and then moved out further if necessary to match the data alignment. The start of the bootloader area is always aligned, see also --dataalignment and --dataalignmentoffset. The bootloader area may be larger than requested due to the alignment, but it's never less than the requested size. To see the bootloader area start and size of an existing PV use pvs -o +pv_ba_start,pv_ba_size. #pvscan Scan one or more devices and record that they are online. #vgscan This option is no longer used. #lvscan This option is no longer used. Specifies the cache metadata format used by cache target. Specifies when writes to a cache LV should be considered complete. \fBwriteback\fP considers a write complete as soon as it is stored in the cache pool. \fBwritethough\fP considers a write complete only when it has been stored in both the cache pool and on the origin LV. While writethrough may be slower for writes, it is more resilient if something should happen to a device associated with the cache pool LV. With \fBpassthrough\fP, all reads are served from the origin LV (all reads miss the cache) and all writes are forwarded to the origin LV; additionally, write hits cause cache block invalidates. See \fBlvmcache\fP(7) for more information. The name of a device to use for a cache. Checks the content of the devices file. Reports incorrect device names or PVIDs for entries. The command profile to use for command configuration. See \fBlvm.conf\fP(5) for more information about profiles. Controls whether compression is enabled or disable for VDO volume. See \fBlvmvdo\fP(7) for more information about VDO usage. Config settings for the command. These override \fBlvm.conf\fP(5) settings. The String arg uses the same format as \fBlvm.conf\fP(5), or may use section/field syntax. See \fBlvm.conf\fP(5) for more information about config. \fBcurrent\fP prints the config settings that would be applied to an lvm command (assuming the command does not override them on the command line.) This includes: settings that have been modified in lvm config files, settings that get their default values from config files, and default settings that have been uncommented in config files. \fBdefault\fP prints all settings with their default values. Changes made in lvm config files are not reflected in the output. Some settings get their default values internally, and these settings are printed as comments. Other settings get their default values from config files, and these settings are not printed as comments. \fBdiff\fP prints only config settings that have been modified from their default values in config files (the difference between current and default.) \fBfull\fP prints every setting uncommented and set to the current value, i.e. how it would be used by an lvm command. This includes settings modified in config files, settings that usually get defaults internally, and settings that get defaults from config files. \fBlist\fP prints all config names without values. \fBmissing\fP prints settings that are missing from the lvm config files. A missing setting that usually gets its default from config files is printed uncommented and set to the internal default. Settings that get their default internally and are not set in config files are printed commented with the internal default. \fBnew\fP prints config settings that have been added since the lvm version specified by --sinceversion. They are printed with their default values. \fBprofilable\fP prints settings with their default values that can be set from a profile. \fBprofilable-command\fP prints settings with their default values that can be set from a command profile. \fBprofilable-metadata\fP prints settings with their default values that can be set from a metadata profile. Also see \fBlvm.conf\fP(5). Align the start of a PV data area with a multiple of this number. To see the location of the first Physical Extent (PE) of an existing PV, use pvs -o +pe_start. In addition, it may be shifted by an alignment offset, see --dataalignmentoffset. Also specify an appropriate PE size when creating a VG. Shift the start of the PV data area by this additional offset. Controls whether deduplication is enabled or disable for VDO volume. See \fBlvmvdo\fP(7) for more information about VDO usage. Deletes a tag from a PV, VG or LV. This option can be repeated to delete multiple tags at once. See \fBlvm\fP(8) for information about tags. Detaches a metadata profile from a VG or LV. See \fBlvm.conf\fP(5) for more information about profiles. The type of device ID to use for the device. If the specified type is available for the device, then it will override the default type that lvm would use. Restricts the devices that are visible and accessible to the command. Devices not listed will appear to be missing. This option can be repeated, or accepts a comma separated list of devices. This overrides the devices file. A file listing devices that LVM should use. The file must exist in \fI#DEFAULT_SYS_DIR#/devices/\fP and is managed with the \fBlvmdevices\fP(8) command. This overrides the \fBlvm.conf\fP(5) \fBdevices/devicesfile\fP and \fBdevices/use_devicesfile\fP settings. Specifies how the device-mapper thin pool layer in the kernel should handle discards. \fBignore\fP causes the thin pool to ignore discards. \fBnopassdown\fP causes the thin pool to process discards itself to allow reuse of unneeded extents in the thin pool. \fBpassdown\fP causes the thin pool to process discards itself (like nopassdown) and pass the discards to the underlying device. See \fBlvmthin\fP(7) for more information. If set to no, the command will not attempt to use device-mapper. For testing and debugging. Dump headers and metadata from a PV for debugging and repair. Option values include: \fBheaders\fP to print and check LVM headers, \fBmetadata\fP to print or save the current text metadata, \fBmetadata_all\fP to list or save all versions of metadata, \fBmetadata_search\fP to list or save all versions of metadata, searching standard locations in case of damaged headers, \fBmetadata_area\fP to save an entire text metadata area to a file. Specifies thin pool behavior when data space is exhausted. When yes, device-mapper will immediately return an error when a thin pool is full and an I/O request requires space. When no, device-mapper will queue these I/O requests for a period of time to allow the thin pool to be extended. Errors are returned if no space is available after the timeout. (Also see dm-thin-pool kernel module option no_space_timeout.) See \fBlvmthin\fP(7) for more information. Force metadata restore even with thin pool LVs. Use with extreme caution. Most changes to thin metadata cannot be reverted. You may lose data if you restore metadata that does not match the thin pool kernel metadata precisely. Report/display foreign VGs that would otherwise be skipped. See \fBlvmsystemid\fP(7) for more information about foreign VGs. Allows a polling operation to continue when PVs are missing, e.g. for repairs due to faulty devices. Exclude advanced configuration settings from the output. Ignore the local section. The local section should be defined in the lvmlocal.conf file, and should contain config settings specific to the local host which should not be copied to other hosts. Allows a command to continue with read-only metadata operations after locking failures. Do not interact with dmeventd unless --monitor is specified. Do not use this if dmeventd is already monitoring a device. Exclude unsupported configuration settings from the output. These settings are either used for debugging and development purposes only or their support is not yet complete and they are not meant to be used in production. The \fBcurrent\fP and \fBdiff\fP types include unsupported settings in their output by default, all the other types ignore unsupported settings. Add devices to the devices file. Record information in the systemd journal. This information is in addition to information enabled by the lvm.conf log/journal setting. command: record information about the command. output: record the default command output. debug: record full command debugging. By default the PV is labelled with an LVM2 identifier in its second sector (sector 1). This lets you use a different sector near the start of the disk (between 0 and 3 inclusive - see LABEL_SCAN_SECTORS in the source). Use with care. Print a list of LVs that use the device. Print the VG that uses the device. Check if all the devices used by a VG or LV are present, and print "complete" or "incomplete" for each listed VG or LV. This option is used as a part of event-based autoactivation, so pvscan will do nothing if this option is set and event_activation=0 in the config settings. Used to pass options for special cases to lvmlockd. See \fBlvmlockd\fP(8) for more information. Start the lockspace of a shared VG in lvmlockd. lvmlockd locks becomes available for the VG, allowing LVM to use the VG. See \fBlvmlockd\fP(8) for more information. Stop the lockspace of a shared VG in lvmlockd. lvmlockd locks become unavailable for the VG, preventing LVM from using the VG. See \fBlvmlockd\fP(8) for more information. #vgchange Change the VG lock type to or from a shared lock type used with lvmlockd. See \fBlvmlockd\fP(8) for more information. #vgcreate Specify the VG lock type directly in place of using --shared. See \fBlvmlockd\fP(8) for more information. Suppress command report and display only log report. Sets the maximum recovery rate for a RAID LV. The rate value is an amount of data per second for each device in the array. Setting the rate to 0 means it will be unbounded. See \fBlvmraid\fP(7) for more information. An alias for --mergethin, --mergemirrors, or --mergesnapshot, depending on the type of LV. Merge LV images that were split from a raid1 LV. See --splitmirrors with --trackchanges. Merge COW snapshot LV into its origin. When merging a snapshot, if both the origin and snapshot LVs are not open, the merge will start immediately. Otherwise, the merge will start the first time either the origin or snapshot LV are activated and both are closed. Merging a snapshot into an origin that cannot be closed, for example a root filesystem, is deferred until the next time the origin volume is activated. When merging starts, the resulting LV will have the origin's name, minor number and UUID. While the merge is in progress, reads or writes to the origin appear as being directed to the snapshot being merged. When the merge finishes, the merged snapshot is removed. Multiple snapshots may be specified on the command line or a @tag may be used to specify multiple snapshots be merged to their respective origin. Merge thin LV into its origin LV. The origin thin LV takes the content of the thin snapshot, and the thin snapshot LV is removed. See \fBlvmthin\fP(7) for more information. When the command is run with --config and/or --commandprofile (or using LVM_COMMAND_PROFILE environment variable), --profile, or --metadataprofile, merge all the contents of the "config cascade" before displaying it. Without merging, only the configuration at the front of the cascade is displayed. See \fBlvm.conf\fP(5) for more information about config. Specifies the metadataignore property of a PV. If yes, metadata areas on the PV are ignored, and lvm will not store metadata in the metadata areas of the PV. If no, lvm will store metadata on the PV. The metadata profile to use for command configuration. See \fBlvm.conf\fP(5) for more information about profiles. The approximate amount of space used for each VG metadata area. The size may be rounded. #lvcreate #lvchange Sets the minor number of an LV block device. #pvscan The minor number of a device. Sets the minimum recovery rate for a RAID LV. The rate value is an amount of data per second for each device in the array. Setting the rate to 0 means it will be unbounded. See \fBlvmraid\fP(7) for more information. Specifies the type of mirror log for LVs with the "mirror" type (does not apply to the "raid1" type.) \fBdisk\fP is a persistent log and requires a small amount of storage space, usually on a separate device from the data being mirrored. \fBcore\fP is not persistent; the log is kept only in memory. In this case, the mirror must be synchronized (by copying LV data from the first device to others) each time the LV is activated, e.g. after reboot. \fBmirrored\fP is a persistent log that is itself mirrored, but should be avoided. Instead, use the raid1 type for log redundancy. Only remove missing PVs from mirror LVs. Also checks the LVM special files in /dev that are needed for active LVs and creates any missing ones and removes unused ones. Start (yes) or stop (no) monitoring an LV with dmeventd. dmeventd monitors kernel events for an LV, and performs automated maintenance for the LV in reponse to specific events. See \fBdmeventd\fP(8) for more information. Add an "LVM2_" prefix plus the field name to the output. Useful with --noheadings to produce a list of field=value pairs that can be used to set environment variables (for example, in udev rules). Suppress the headings line that is normally the first line of output. Useful if grepping the output. Do not use the hints file to locate devices for PVs. A command may read more devices to find PVs when hints are not used. The command will still perform standard hint file invalidation where appropriate. Do not record history of LVs being removed. This has no effect unless the configuration setting metadata/record_lvs_history is enabled. In conjunction with --uuid, this allows a uuid to be specified without also requiring that a backup of the metadata be provided. Suppress the suffix on output sizes. Use with --units (except h and H) if processing the output. Causes the creation of mirror, raid1, raid4, raid5 and raid10 to skip the initial synchronization. In case of mirror, raid1 and raid10, any data written afterwards will be mirrored, but the original contents will not be copied. In case of raid4 and raid5, no parity blocks will be written, though any data written afterwards will cause parity blocks to be stored. This is useful for skipping a potentially long and resource intensive initial sync of an empty mirror/raid1/raid4/raid5 and raid10 LV. This option is not valid for raid6, because raid6 relies on proper parity (P and Q Syndromes) being created during initial synchronization in order to reconstruct proper user date in case of device failures. raid0 and raid0_meta do not provide any data copies or parity support and thus do not support initial synchronization. Send a notification to D-Bus. The command will exit with an error if LVM is not built with support for D-Bus notification, or if the notify_dbus config setting is disabled. Disables udev synchronisation. The process will not wait for notification from udev. It will continue irrespective of any possible udev processing in the background. Only use this if udev is not running or has rules that ignore the devices LVM creates. Specifies the name to use for the external origin LV when converting an LV to a thin LV. The LV being converted becomes a read-only external origin with this name. Overrides the automatically detected size of the PV. Use with care, or prior to reducing the physical size of the device. Specifies command specific settings in "Key = Value" form. Combine multiple settings in quotes, or repeat the settings option for each. When yes, start the background transformation of an LV. An incomplete transformation, e.g. pvmove or lvconvert interrupted by reboot or crash, can be restarted from the last checkpoint with --poll y. When no, background transformation of an LV will not occur, and the transformation will not complete. It may not be appropriate to immediately poll an LV after activation, in which case --poll n can be used to defer polling until a later --poll y command. The command to perform from lvmpolld. The name of a an LV to use for storing pool metadata. #lvcreate #lvconvert Specifies the size of the new pool metadata LV. #lvresize #lvextend Specifies the new size of the pool metadata LV. The plus prefix \fB+\fP can be used, in which case the value is added to the current size. Enable or disable the automatic creation and management of a spare pool metadata LV in the VG. A spare metadata LV is reserved space that can be used when repairing a pool. An alias for --commandprofile or --metadataprofile, depending on the command. The number of metadata areas to set aside on a PV for storing VG metadata. When 2, one copy of the VG metadata is stored at the front of the PV and a second copy is stored at the end. When 1, one copy of the VG metadata is stored at the front of the PV. When 0, no copies of the VG metadata are stored on the given PV. This may be useful in VGs containing many PVs (this places limitations on the ability to use vgsplit later.) Enable or disable data integrity checksums for raid images. The block size to use for dm-integrity on raid images. The integrity block size should usually match the device logical block size, or the file system block size. It may be less than the file system block size, but not less than the device logical block size. Possible values: 512, 1024, 2048, 4096. Use a journal (default) or bitmap for keeping integrity checksums consistent in case of a crash. The bitmap areas are recalculated after a crash, so corruption in those areas would not be detected. A journal does not have this problem. The journal mode doubles writes to storage, but can improve performance for scattered writes packed into a single journal write. bitmap mode can in theory achieve full write throughput of the device, but would not benefit from the potential scattered write optimization. Run the command in a special read-only mode which will read on-disk metadata without needing to take any locks. This can be used to peek inside metadata used by a virtual machine image while the virtual machine is running. No attempt will be made to communicate with the device-mapper kernel driver, so this option is unable to report whether or not LVs are actually in use. If the LV is active, reload its metadata. This is not necessary in normal operation, but may be useful if something has gone wrong, or if some form of manual LV sharing is being used. Removes all missing PVs from the VG, if there are no LVs allocated on them. This resumes normal operation of the VG (new LVs may again be created, changed and so on). If this is not possible because LVs are referencing the missing PVs, this option can be combined with --force to have the command remove any partial LVs. In this case, any LVs and dependent snapshots that were partly on the missing disks are removed completely, including those parts on disks that are still present. If LVs spanned several disks, including ones that are lost, salvaging some data first may be possible by activating LVs in partial mode. Selects a PV to rebuild in a raid LV. Multiple PVs can be rebuilt by repeating this option. Use this option in place of --resync or --syncaction repair when the PVs with corrupted data are known, and their data should be reconstructed rather than reconstructing default (rotating) data. See \fBlvmraid\fP(7) for more information. #lvconvert Replace failed PVs in a raid or mirror LV, or run a repair utility on a thin pool. See \fBlvmraid\fP(7) and \fBlvmthin\fP(7) for more information. #pvck Repair headers and metadata on a PV. Repair headers and metadata on a PV. See command description. Replace a specific PV in a raid LV with another PV. The new PV to use can be optionally specified after the LV. Multiple PVs can be replaced by repeating this option. See \fBlvmraid\fP(7) for more information. Overrides current output format for reports which is defined globally by the report/output_format setting in \fBlvm.conf\fP(5). \fBbasic\fP is the original format with columns and rows. If there is more than one report per command, each report is prefixed with the report name for identification. \fBjson\fP produces report output in JSON format. See \fBlvmreport\fP(7) for more information. In conjunction with --uuid, this reads the file (produced by vgcfgbackup), extracts the location and size of the data on the PV, and ensures that the metadata produced by the program is consistent with the contents of the file, i.e. the physical extents will be in the same place and not be overwritten by new metadata. This provides a mechanism to upgrade the metadata format or to add/remove metadata areas. Use with care. Add a PV back into a VG after the PV was missing and then returned, e.g. due to a transient failure. The PV is not reinitialized. Initiates mirror synchronization. Synchronization generally happens automatically, but this option forces it to run. Also see --rebuild to synchronize a specific PV. During synchronization, data is read from the primary mirror device and copied to the others. This can take considerable time, during which the LV is without a complete redundant copy of the data. See \fBlvmraid\fP(7) for more information. #pvs Produces one line of output for each contiguous allocation of space on each PV, showing the start (pvseg_start) and length (pvseg_size) in units of physical extents. #lvs Use default columns that emphasize segment information. String to use to separate each column. Useful if grepping the output. #vgcreate Create a shared VG using lvmlockd if LVM is compiled with lockd support. lvmlockd will select lock type sanlock or dlm depending on which lock manager is running. This allows multiple hosts to share a VG on shared devices. lvmlockd and a lock manager must be configured and running. See \fBlvmlockd\fP(8) for more information about shared VGs. #vgs #lvs #pvs #fullreport #vgdisplay #lvdisplay #pvdisplay Report/display shared VGs that would otherwise be skipped when lvmlockd is not being used on the host. See \fBlvmlockd\fP(8) for more information about shared VGs. Specify an LVM version in x.y.z format where x is the major version, the y is the minor version and z is the patchlevel (e.g. 2.2.106). This option is currently applicable only with --typeconfig new to display all configuration settings introduced since given version. Separates a cache pool from a cache LV, and keeps the unused cache pool LV. Before the separation, the cache is flushed. Also see --uncache. Splits the specified number of images from a raid1 or mirror LV and uses them to create a new LV. If --trackchanges is also specified, changes to the raid1 LV are tracked while the split LV remains detached. If --name is specified, then the images are permanently split from the original LV and changes are not tracked. Separates a COW snapshot from its origin LV. The LV that is split off contains the chunks that differ from the origin LV along with metadata describing them. This LV can be wiped and then destroyed with lvremove. Include deprecated configuration settings in the output. These settings are deprecated after a certain version. If a concrete version is specified with --atversion, deprecated settings are automatically included if the specified version is lower than the version in which the settings were deprecated. The current and diff types include deprecated settings in their output by default, all the other types ignore deprecated settings. Include unsupported configuration settings in the output. These settings are either used for debugging or development purposes only, or their support is not yet complete and they are not meant to be used in production. The current and diff types include unsupported settings in their output by default, all the other types ignore unsupported settings. Start polling an LV to continue processing a conversion. Specifies the number of stripes in a striped LV. This is the number of PVs (devices) that a striped LV is spread across. Data that appears sequential in the LV is spread across multiple devices in units of the stripe size (see --stripesize). This does not apply to existing allocated space, only newly allocated space can be striped. Extracts the metadata LV from a pool and replaces it with another specified LV. The extracted LV is preserved and given the name of the LV that replaced it. Use for repair only. When the metadata LV is swapped out of the pool, it can be activated directly and used with thin provisioning tools: \fBcache_dump\fP(8), \fBcache_repair\fP(8), \fBcache_restore\fP(8), \fBthin_dump\fP(8), \fBthin_repair\fP(8), \fBthin_restore\fP(8). Initiate different types of RAID synchronization. This causes the RAID LV to read all data and parity blocks in the array and check for discrepancies (mismatches between mirrors or incorrect parity values). \fBcheck\fP will count but not correct discrepancies. \fBrepair\fP will correct discrepancies. See \fBlvs\fP(8) for reporting discrepancies found or repaired. Indicates that vgchange/lvchange is being invoked from early system initialisation scripts (e.g. rc.sysinit or an initrd), before writable filesystems are available. As such, some functionality needs to be disabled and this option acts as a shortcut which selects an appropriate set of options. Currently, this is equivalent to using --ignorelockingfailure, --ignoremonitoring, --poll n, and setting env var LVM_SUPPRESS_LOCKING_FAILURE_MESSAGES. vgchange/lvchange skip autoactivation, and defer to pvscan autoactivation. #vgcreate Specifies the system ID that will be given to the new VG, overriding the system ID of the host running the command. A VG is normally created without this option, in which case the new VG is given the system ID of the host creating it. Using this option requires caution because the system ID of the new VG may not match the system ID of the host running the command, leaving the VG inaccessible to the host. See \fBlvmsystemid\fP(7) for more information. #vgchange Changes the system ID of the VG. Using this option requires caution because the VG may become foreign to the host running the command, leaving the host unable to access it. See \fBlvmsystemid\fP(7) for more information. Can be used with --splitmirrors on a raid1 LV. This causes changes to the original raid1 LV to be tracked while the split images remain detached. This is a temporary state that allows the read-only detached image to be merged efficiently back into the raid1 LV later. Only the regions with changed data are resynchronized during merge. While a raid1 LV is tracking changes, operations on it are limited to merging the split image (see --mergemirrors) or permanently splitting the image (see --splitmirrors with --name. The LV type, also known as "segment type" or "segtype". See usage descriptions for the specific ways to use these types. For more information about redundancy and performance (\fBraid\fP, \fBmirror\fP, \fBstriped\fP, \fBlinear\fP) see \fBlvmraid\fP(7). For thin provisioning (\fBthin\fP, \fBthin-pool\fP) see \fBlvmthin\fP(7). For performance caching (\fBcache\fP, \fBcache-pool\fP) see \fBlvmcache\fP(7). For copy-on-write snapshots (\fBsnapshot\fP) see usage definitions. For VDO (\fBvdo\fP) see \fBlvmvdo\fP(7). Several commands omit an explicit type option because the type is inferred from other options or shortcuts (e.g. --stripes, --mirrors, --snapshot, --virtualsize, --thin, --cache, --vdo). Use inferred types with care because it can lead to unexpected results. Command output is modified to be imported from a udev rule. Produce output immediately without sorting or aligning the columns properly. Separates a cache pool from a cache LV, and deletes the unused cache pool LV. Before the separation, the cache is flushed. Also see --splitcache. Update the content of the devices file. Specifies the cache policy for a cache LV. See \fBlvmcache\fP(7) for more information. Specifies tunable values for a cache LV in "Key = Value" form. Repeat this option to specify multiple values. (The default values should usually be adequate.) The special string value \fBdefault\fP switches settings back to their default kernel values and removes them from the list of settings stored in LVM metadata. See \fBlvmcache\fP(7) for more information. Internal option used for generating config file during build. All sizes are output in these units: human-(r)eadable with '<' rounding indicator, (h)uman-readable, (b)ytes, (s)ectors, (k)ilobytes, (m)egabytes, (g)igabytes, (t)erabytes, (p)etabytes, (e)xabytes. Capitalise to use multiples of 1000 (S.I.) instead of 1024. Custom units can be specified, e.g. --units 3M. When used with --nameprefixes, output values in the field=value pairs are not quoted. Perform an operation according to the policy configured in \fBlvm.conf\fP(5) or a profile. Validate current configuration used and exit with appropriate return code. The validation is done only for the configuration at the front of the "config cascade". To validate the whole merged configuration tree, also use --mergedconfig. The validation is done even if \fBlvm.conf\fP(5) \fBconfig/checks\fP is disabled. Specifies the command is handling VDO LV. See --type vdo. See \fBlvmvdo\fP(7) for more information about VDO usage. The name of a VDO pool LV. See \fBlvmvdo\fP(7) for more information about VDO usage. Specifies tunable VDO options for VDO LVs. Use the form 'option=value' or 'option1=value option2=value', or repeat --vdosettings for each option being set. These settings override the default VDO behaviors. To remove vdosettings and revert to the default VDO behaviors, use --vdosettings 'default'. See \fBlvmvdo\fP(7) for more information. Number of copies of the VG metadata that are kept. VG metadata is kept in VG metadata areas on PVs in the VG, i.e. reserved space at the start and/or end of the PVs. Keeping a copy of the VG metadata on every PV can reduce performance in VGs containing a large number of PVs. When this number is set to a non-zero value, LVM will automatically choose PVs on which to store metadata, using the metadataignore flags on PVs to achieve the specified number. The number can also be replaced with special string values: \fBunmanaged\fP causes LVM to not automatically manage the PV metadataignore flags. \fBall\fP causes LVM to first clear the metadataignore flags on all PVs, and then to become unmanaged. The first command to see a complete VG will report it uniquely. Other commands to see the complete VG will report it differently. Display a one line comment for each configuration node. Display a full comment for each configuration node. For deprecated settings, also display comments about deprecation. Include general config file preamble. Include local config file preamble. Where appropriate, add more spaces in output for better readability. Also display a comment containing the version of introduction for each configuration node. If the setting is deprecated, also display the version since which it is deprecated. The maximum number of outstanding writes that are allowed to devices in a RAID1 LV that is marked write-mostly. Once this value is exceeded, writes become synchronous (i.e. all writes to the constituent devices must complete before the array signals the write has completed). Setting the value to zero clears the preference and allows the system to choose the value arbitrarily. Mark a device in a RAID1 LV as write-mostly. All reads to these drives will be avoided unless absolutely necessary. This keeps the number of I/Os to the drive to a minimum. The default behavior is to set the write-mostly attribute for the specified PV. It is also possible to remove the write-mostly flag by adding the suffix \fB:n\fP at the end of the PV name, or to toggle the value with the suffix \fB:t\fP. Repeat this option to change the attribute on multiple PVs. #pvscan Auto-activate LVs in a VG when the PVs scanned have completed the VG. (Only \fBay\fP is applicable.) #lvchange #vgchange Change the active state of LVs. An active LV can be used through a block device, allowing data on the LV to be accessed. \fBy\fP makes LVs active, or available. \fBn\fP makes LVs inactive, or unavailable. The block device for the LV is added or removed from the system using device-mapper in the kernel. A symbolic link /dev/VGName/LVName pointing to the device node is also added/removed. All software and scripts should access the device through the symbolic link and present this as the name of the device. The location and name of the underlying device node may depend on the distribution, configuration (e.g. udev), or release version. \fBay\fP specifies autoactivation, which is used by system-generated activation commands. By default, LVs are autoactivated. An autoactivation property can be set on a VG or LV to disable autoactivation, see --setautoactivation y|n in vgchange, lvchange, vgcreate, and lvcreate. Display the property with vgs or lvs "-o autoactivation". The \fBlvm.conf\fP(5) auto_activation_volume_list includes names of VGs or LVs that should be autoactivated, and anything not listed is not autoactivated. When auto_activation_volume_list is undefined (the default), it has no effect. If auto_activation_volume_list is defined and empty, no LVs are autoactivated. Items included by auto_activation_volume_list will not be autoactivated if the autoactivation property has been disabled. See \fBlvmlockd\fP(8) for more information about activation options \fBey\fP and \fBsy\fP for shared VGs. #lvcreate Controls the active state of the new LV. \fBy\fP makes the LV active, or available. New LVs are made active by default. \fBn\fP makes the LV inactive, or unavailable, only when possible. In some cases, creating an LV requires it to be active. For example, COW snapshots of an active origin LV can only be created in the active state (this does not apply to thin snapshots). The --zero option normally requires the LV to be active. If autoactivation \fBay\fP is used, the LV is only activated if it matches an item in \fBlvm.conf\fP(5) \fBactivation/auto_activation_volume_list\fP. \fBay\fP implies --zero n and --wipesignatures n. See \fBlvmlockd\fP(8) for more information about activation options for shared VGs. #vgreduce Removes all empty PVs if none are named on the command line. #pvchange Change all visible PVs. #vgimport Import all visible VGs. #lvscan #lvdisplay #lvs Show information about internal LVs. These are components of normal LVs, such as mirrors, which are not independently accessible, e.g. not mountable. #vgs List all VGs. Equivalent to not specifying any VGs. #pvs #pvdisplay Show information about devices that have not been initialized by LVM, i.e. they are not PVs. Specifies if metadata should be backed up automatically after a change. Enabling this is strongly advised! See \fBvgcfgbackup\fP(8) for more information. Only select active VGs. The VG is considered active if at least one of its LVs is active. If the operation requires polling, this option causes the command to return before the operation is complete, and polling is done in the background. By default the snapshot VG will be renamed to the original name plus a numeric suffix to avoid duplicate naming (e.g. 'test_vg' would be renamed to 'test_vg1'). This option will override the base VG name that is used for all VG renames. If a VG already exists with the specified name a numeric suffix will be added (like the previous example) to make it unique. The size of chunks in a snapshot, cache pool or thin pool. For snapshots, the value must be a power of 2 between 4KiB and 512KiB and the default value is 4. For a cache pool the value must be between 32KiB and 1GiB and the default value is 64. For a thin pool the value must be between 64KiB and 1GiB and the default value starts with 64 and scales up to fit the pool metadata size within 128MiB, if the pool metadata size is not specified. The value must be a multiple of 64KiB. See \fBlvmthin\fP(7) and \fBlvmcache\fP(7) for more information. This option was specific to clvm and is now replaced by the --shared option with \fBlvmlockd\fP(8). Generate colon separated output for easier parsing in scripts or programs. Also see \fBvgs\fP(8) which provides considerably more control over the output. Display output in columns, the equivalent of \fBvgs\fP(8). Options listed are the same as options given in \fBvgs\fP(8). Sets or resets the contiguous allocation policy for LVs. Default is no contiguous allocation based on a next free principle. It is only possible to change a non-contiguous allocation policy to contiguous if all of the allocated physical extents in the LV are already contiguous. Set debug level. Repeat from 1 to 6 times to increase the detail of messages sent to the log file and/or syslog (if configured). Only show PVs belonging to exported VGs. #pvck Metadata file to read or write. #lvmconfig #dumpconfig #config Write output to the named file. #vgcfgbackup Write the backup to the named file. When backing up more than one VG, the file name is treated as a template, and %s is replaced by the VG name. #vgcfgrestore Read metadata backup from the named file. Usually this file was created by vgcfgbackup. Override various checks, confirmations and protections. Use with extreme caution. Specifies the command is handling a cache LV or cache pool. See --type cache and --type cache-pool. See \fBlvmcache\fP(7) for more information about LVM caching. Include historical LVs in the output. (This has no effect unless LVs were removed while \fBlvm.conf\fP(5) \fBmetadata/record_lvs_history\fP was enabled. Import exported VGs. Otherwise VGs that have been exported will not be changed (nor will their associated PVs). Report progress at regular intervals. Specifies the number of stripes in a striped LV. This is the number of PVs (devices) that a striped LV is spread across. Data that appears sequential in the LV is spread across multiple devices in units of the stripe size (see --stripesize). This does not change existing allocated space, but only applies to space being allocated by the command. When creating a RAID 4/5/6 LV, this number does not include the extra devices that are required for parity. The largest number depends on the RAID type (raid0: 64, raid10: 32, raid4/5: 63, raid6: 62), and when unspecified, the default depends on the RAID type (raid0: 2, raid10: 2, raid4/5: 3, raid6: 5.) To stripe a new raid LV across all PVs by default, see \fBlvm.conf\fP(5) \fBallocation/raid_stripe_all_devices\fP. The amount of data that is written to one device before moving to the next in a striped LV. Sets the maximum number of LVs allowed in a VG. #lvcreate Specifies the size of the new LV in logical extents. The --size and --extents options are alternate methods of specifying size. The total number of physical extents used will be greater when redundant data is needed for RAID levels. An alternate syntax allows the size to be determined indirectly as a percentage of the size of a related VG, LV, or set of PVs. The suffix \fB%VG\fP denotes the total size of the VG, the suffix \fB%FREE\fP the remaining free space in the VG, and the suffix \fB%PVS\fP the free space in the specified PVs. For a snapshot, the size can be expressed as a percentage of the total size of the origin LV with the suffix \fB%ORIGIN\fP (\fB100%ORIGIN\fP provides space for the whole origin). When expressed as a percentage, the size defines an upper limit for the number of logical extents in the new LV. The precise number of logical extents in the new LV is not determined until the command has completed. #lvreduce #lvextend #lvresize Specifies the new size of the LV in logical extents. The --size and --extents options are alternate methods of specifying size. The total number of physical extents used will be greater when redundant data is needed for RAID levels. An alternate syntax allows the size to be determined indirectly as a percentage of the size of a related VG, LV, or set of PVs. The suffix \fB%VG\fP denotes the total size of the VG, the suffix \fB%FREE\fP the remaining free space in the VG, and the suffix \fB%PVS\fP the free space in the specified PVs. For a snapshot, the size can be expressed as a percentage of the total size of the origin LV with the suffix \fB%ORIGIN\fP (\fB100%ORIGIN\fP provides space for the whole origin). When expressed as a percentage, the size defines an upper limit for the number of logical extents in the new LV. The precise number of logical extents in the new LV is not determined until the command has completed. When the plus \fB+\fP or minus \fB-\fP prefix is used, the value is not an absolute size, but is relative and added or subtracted from the current size. #lvmconfig #dumpconfig #config List config settings with summarizing comment. This is the same as using options --typeconfig list --withsummary. #vgcfgrestore List metadata backup and archive files pertaining to the VG. May be used with --file. Does not restore the VG. #vgmerge Display merged destination VG like vgdisplay -v. #lvcreate Specifies the size of the new LV. The --size and --extents options are alternate methods of specifying size. The total number of physical extents used will be greater when redundant data is needed for RAID levels. #lvreduce #lvextend #lvresize Specifies the new size of the LV. The --size and --extents options are alternate methods of specifying size. The total number of physical extents used will be greater when redundant data is needed for RAID levels. When the plus \fB+\fP or minus \fB-\fP prefix is used, the value is not an absolute size, but is relative and added or subtracted from the current size. When yes, makes the specified minor number persistent. #lvcreate #lvchange Sets the major number of an LV block device. #pvscan The major number of a device. Persistently sets (yes) or clears (no) the "activation skip" flag on an LV. An LV with this flag set is not activated unless the --ignoreactivationskip option is used by the activation command. This flag is set by default on new thin snapshot LVs. The flag is not applied to deactivation. The current value of the flag is indicated in the lvs lv_attr bits. Ignore the "activation skip" LV flag during activation to allow LVs with the flag set to be activated. #lvdisplay Display the mapping of logical extents to PVs and physical extents. To map physical extents to logical extents use: pvs --segments -o+lv_name,seg_start_pe,segtype #pvdisplay Display the mapping of physical extents to LVs and logical extents. #lvcreate Specifies the number of mirror images in addition to the original LV image, e.g. --mirrors 1 means there are two images of the data, the original and one mirror image. Optional positional PV args on the command line can specify the devices the images should be placed on. There are two mirroring implementations: "raid1" and "mirror". These are the names of the corresponding LV types, or "segment types". Use the --type option to specify which to use (raid1 is default, and mirror is legacy) Use \fBlvm.conf\fP(5) \fBglobal/mirror_segtype_default\fP and global/raid10_segtype_default to configure the default types. See the --nosync option for avoiding initial image synchronization. See \fBlvmraid\fP(7) for more information. #lvconvert Specifies the number of mirror images in addition to the original LV image, e.g. --mirrors 1 means there are two images of the data, the original and one mirror image. Optional positional PV args on the command line can specify the devices the images should be placed on. There are two mirroring implementations: "raid1" and "mirror". These are the names of the corresponding LV types, or "segment types". Use the --type option to specify which to use (raid1 is default, and mirror is legacy) Use \fBlvm.conf\fP(5) \fBglobal/mirror_segtype_default\fP and global/raid10_segtype_default to configure the default types. The plus prefix \fB+\fP can be used, in which case the number is added to the current number of images, or the minus prefix \fB-\fP can be used, in which case the number is subtracted from the current number of images. See \fBlvmraid\fP(7) for more information. #lvextend Not used. Specifies the type of on-disk metadata to use. \fBlvm2\fP (or just \fB2\fP) is the current, standard format. \fBlvm1\fP (or just \fB1\fP) is no longer used. #lvcreate #lvconvert Specifies the name of a new LV. When unspecified, a default name of "lvol#" is generated, where # is a number generated by LVM. #pvmove Move only the extents belonging to the named LV. #vgsplit Move only PVs used by the named LV. Do not perform fsck before resizing filesystem when filesystem requires it. You may need to use --force to proceed with this option. Only show PVs not belonging to any VG. Comma-separated, ordered list of fields to display in columns. String arg syntax is: [\fB+\fP|\fB-\fP|\fB#\fP]\fIField1\fP[\fB,\fP\fIField2\fP ...] The prefix \fB+\fP will append the specified fields to the default fields, \fB-\fP will remove the specified fields from the default fields, and \fB#\fP will compact specified fields (removing them when empty for all rows.) Use \fB-o help\fP to view the list of all available fields. Use separate lists of fields to add, remove or compact by repeating the -o option: -o+field1,field2 -o-field3,field4 -o#field5. These lists are evaluated from left to right. Use field name \fBlv_all\fP to view all LV fields, \fBvg_all\fP all VG fields, \fBpv_all\fP all PV fields, \fBpvseg_all\fP all PV segment fields, \fBseg_all\fP all LV segment fields, and \fBpvseg_all\fP all PV segment columns. See the \fBlvm.conf\fP(5) report section for more config options. See \fBlvmreport\fP(7) for more information about reporting. Comma-separated ordered list of columns to sort by. Replaces the default selection. Precede any column with \fB-\fP for a reverse sort on that column. Sets the maximum number of PVs that can belong to the VG. The value 0 removes any limitation. For large numbers of PVs, also see options --pvmetadatacopies, and --vgmetadatacopies for improving performance. Set access permission to read only \fBr\fP or read and write \fBrw\fP. Commands will do their best to activate LVs with missing PV extents. Missing extents may be replaced with error or zero segments according to the missing_stripe_filler setting. Metadata may not be changed with this option. Suppress output and log messages. Overrides --debug and --verbose. Repeat once to also suppress any prompts with answer 'no'. Sets read ahead sector count of an LV. \fBauto\fP is the default which allows the kernel to choose a suitable value automatically. \fBnone\fP is equivalent to zero. Resize underlying filesystem together with the LV using \fBfsadm\fP(8). Size of each raid or mirror synchronization region. \fBlvm.conf\fP(5) \fBactivation/raid_region_size\fP can be used to configure a default. #vgcreate Sets the physical extent size of PVs in the VG. The value must be either a power of 2 of at least 1 sector (where the sector size is the largest sector size of the PVs currently used in the VG), or at least 128KiB. Once this value has been set, it is difficult to change without recreating the VG, unless no extents need moving. #vgchange Sets the physical extent size of PVs in the VG. The value must be either a power of 2 of at least 1 sector (where the sector size is the largest sector size of the PVs currently used in the VG), or at least 128KiB. Once this value has been set, it is difficult to change without recreating the VG, unless no extents need moving. Before increasing the physical extent size, you might need to use lvresize, pvresize and/or pvmove so that everything fits. For example, every contiguous range of extents used in a LV must start and end on an extent boundary. #lvcreate Create a snapshot. Snapshots provide a "frozen image" of an origin LV. The snapshot LV can be used, e.g. for backups, while the origin LV continues to be used. This option can create a COW (copy on write) snapshot, or a thin snapshot (in a thin pool.) Thin snapshots are created when the origin is a thin LV and the size option is NOT specified. Thin snapshots share the same blocks in the thin pool, and do not allocate new space from the VG. Thin snapshots are created with the "activation skip" flag, see --setactivationskip. A thin snapshot of a non-thin "external origin" LV is created when a thin pool is specified. Unprovisioned blocks in the thin snapshot LV are read from the external origin LV. The external origin LV must be read-only. See \fBlvmthin\fP(7) for more information about LVM thin provisioning. COW snapshots are created when a size is specified. The size is allocated from space in the VG, and is the amount of space that can be used for saving COW blocks as writes occur to the origin or snapshot. The size chosen should depend upon the amount of writes that are expected; often 20% of the origin LV is enough. If COW space runs low, it can be extended with lvextend (shrinking is also allowed with lvreduce.) A small amount of the COW snapshot LV size is used to track COW block locations, so the full size is not available for COW data blocks. Use lvs to check how much space is used, and see --monitor to to automatically extend the size to avoid running out of space. #lvconvert Combine a former COW snapshot LV with a former origin LV to reverse a previous --splitsnapshot command. #pvdisplay Only display the size of the given PVs. #vgdisplay Give a short listing showing the existence of VGs. #pvscan Short listing format. Select objects for processing and reporting based on specified criteria. The criteria syntax is described by \fB--select help\fP and \fBlvmreport\fP(7). For reporting commands, one row is displayed for each object matching the criteria. See \fB--options help\fP for selectable object fields. Rows can be displayed with an additional "selected" field (-o selected) showing 1 if the row matches the selection and 0 otherwise. For non-reporting commands which process LVM entities, the selection is used to choose items to process. Run in test mode. Commands will not update metadata. This is implemented by disabling all metadata writing but nevertheless returning success to the calling function. This may lead to unusual error messages in multi-stage operations if a tool relies on reading back metadata it believes has changed but hasn't. Specifies the command is handling a thin LV or thin pool. See --type thin, --type thin-pool, and --virtualsize. See \fBlvmthin\fP(7) for more information about LVM thin provisioning. Update VG metadata to correct problems. If VG metadata was updated while a PV was missing, and the PV reappears with an old version of metadata, then this option (or any other command that writes metadata) will update the metadata on the previously missing PV. If a PV was removed from a VG while it was missing, and the PV reappears, using this option will clear the outdated metadata from the previously missing PV. If metadata text is damaged on one PV, using this option will replace the damaged metadata text. For more severe damage, e.g. with headers, see \fBpvck\fP(8). #pvchange Generate new random UUID for specified PVs. #pvscan Show UUIDs in addition to device names. #vgchange Generate new random UUID for specified VGs. Specify a UUID for the device. Without this option, a random UUID is generated. This option is needed before restoring a backup of LVM metadata onto a replacement device; see \fBvgcfgrestore\fP(8). As such, use of --restorefile is compulsory unless the --norestorefile is used. All PVs must have unique UUIDs, and LVM will prevent certain operations if multiple devices are seen with the same UUID. See \fBvgimportclone\fP(8) for more information. Set verbose level. Repeat from 1 to 4 times to increase the detail of messages sent to stdout and stderr. The virtual size of a new thin LV. See \fBlvmthin\fP(7) for more information about LVM thin provisioning. Using virtual size (-V) and actual size (-L) together creates a sparse LV. \fBlvm.conf\fP(5) \fBglobal/sparse_segtype_default\fP determines the default segment type used to create a sparse LV. Anything written to a sparse LV will be returned when reading from it. Reading from other areas of the LV will return blocks of zeros. When using a snapshot to create a sparse LV, a hidden virtual device is created using the zero target, and the LV has the suffix _vorigin. Snapshots are less efficient than thin provisioning when creating large sparse LVs (GiB). Controls detection and subsequent wiping of signatures on new LVs. There is a prompt for each signature detected to confirm its wiping (unless --yes is used to override confirmations.) When not specified, signatures are wiped whenever zeroing is done (see --zero). This behaviour can be configured with \fBlvm.conf\fP(5) \fBallocation/wipe_signatures_when_zeroing_new_lvs\fP. If blkid wiping is used (\fBlvm.conf\fP(5) \fBallocation/use_blkid_wiping\fP) and LVM is compiled with blkid wiping support, then the blkid(8) library is used to detect the signatures (use blkid -k to list the signatures that are recognized). Otherwise, native LVM code is used to detect signatures (only MD RAID, swap and LUKS signatures are detected in this case.) The LV is not wiped if the read only flag is set. Enable or disable allocation of physical extents on this PV. Enables or disables the addition or removal of PVs to/from a VG (by vgextend/vgreduce). Do not prompt for confirmation interactively but always assume the answer yes. Use with extreme caution. (For automatic no, see -qq.) #lvchange Set zeroing mode for thin pool. Note: already provisioned blocks from pool in non-zero mode are not cleared in unwritten parts when setting --zero y. #lvconvert For snapshots, this controls zeroing of the first 4KiB of data in the snapshot. If the LV is read-only, the snapshot will not be zeroed. For thin pools, this controls zeroing of provisioned blocks. Provisioning of large zeroed chunks negatively impacts performance. #lvcreate Controls zeroing of the first 4KiB of data in the new LV. Default is \fBy\fP. Snapshot COW volumes are always zeroed. For thin pools, this controls zeroing of provisioned blocks. LV is not zeroed if the read only flag is set. Warning: trying to mount an unzeroed LV can cause the system to hang. #pvcreate #vgcreate #vgextend Controls if the first 4 sectors (2048 bytes) of the device are wiped. The default is to wipe these sectors unless either or both of --restorefile or --uuid are specified. writethrough|writeback|passthrough[Number]r|R|h|H|b|B|s|S|k|K|m|M|g|G|t|T|p|P|e|Elinear|striped|snapshot|raid|mirror|thin|thin-pool|vdo|vdo-pool|cache|cache-pool|writecachecontiguous|cling|cling_by_tags|normal|anywhere|inheritpvmove|convert|merge|merge_thincurrent|default|diff|full|list|missing|new|profilable|profilable-command|profilable-metadatapv_header|metadata|label_headerheaders|metadata|metadata_all|metadata_searchТOO_ALL: --commandprofile String, --config String, --debug, --driverloaded Bool, --help, --nolocking, --lockopt String, --longhelp, --profile String, --quiet, --verbose, --version, --yes, --test, --devicesfile String, --devices PV, --nohints --journal String OO_REPORT: --aligned, --all, --binary, --configreport ConfigReport, --foreign, --ignorelockingfailure, --logonly, --nameprefixes, --noheadings, --nosuffix, --options String, --readonly, --reportformat ReportFmt, --rows, --select String, --separator String, --shared, --sort String, --unbuffered, --units Units, --unquoted OO_CONFIG: --atversion String, --typeconfig ConfigType, --file String, --ignoreadvanced, --ignoreunsupported, --ignorelocal, --list, --mergedconfig, --metadataprofile String, --sinceversion String, --showdeprecated, --showunsupported, --validate, --withsummary, --withcomments, --withgeneralpreamble, --withlocalpreamble, --withspaces, --unconfigured, --withversions OO_LVCHANGE: --autobackup Bool, --force, --ignoremonitoring, --noudevsync, --reportformat ReportFmt, --select String OO_LVCHANGE_META: --addtag Tag, --deltag Tag, --alloc Alloc, --contiguous Bool, --compression Bool, --deduplication Bool, --detachprofile, --metadataprofile String, --profile String, --permission Permission, --readahead Readahead, --setactivationskip Bool, --setautoactivation Bool, --errorwhenfull Bool, --discards Discards, --zero Bool, --cachemode CacheMode, --cachepolicy String, --cachesettings String, --minrecoveryrate SizeKB, --maxrecoveryrate SizeKB, --vdosettings String, --writebehind Number, --writemostly WriteMostlyPV, --persistent n lvchange OO_LVCHANGE_META VG|LV|Tag|Select ... OO: --activate Active, --poll Bool, --monitor Bool, OO_LVCHANGE IO: --ignoreskippedcluster ID: lvchange_properties DESC: Change a general LV attribute. DESC: For options listed in parentheses, any one is DESC: required, after which the others are optional. RULE: all not lv_is_pvmove lv_is_mirror_log lv_is_mirror_image RULE: all and lv_is_vg_writable RULE: --contiguous not --alloc RULE: --profile not --detachprofile RULE: --metadataprofile not --detachprofile RULE: --minrecoveryrate --maxrecoveryrate and LV_raid RULE: --writebehind --writemostly and LV_raid1 RULE: --cachemode --cachepolicy --cachesettings and LV_cache LV_cachepool LV_writecache RULE: --errorwhenfull --discards --zero and LV_thinpool RULE: --permission not lv_is_external_origin lv_is_raid_metadata lv_is_raid_image LV_thinpool RULE: --alloc --contiguous --metadataprofile --persistent --profile --readahead not lv_is_thick_origin RULE: --alloc --discards --zero --cachemode --cachepolicy --cachesettings not lv_is_partial lvchange --resync VG|LV_raid_mirror|Tag|Select ... OO: --activate Active, OO_LVCHANGE IO: --ignoreskippedcluster ID: lvchange_resync DESC: Resyncronize a mirror or raid LV. DESC: Use to reset 'R' attribute on a not initially synchronized LV. RULE: all not lv_is_pvmove lv_is_locked lv_is_raid_with_integrity RULE: all not LV_raid0 lvchange --syncaction SyncAction VG|LV_raid|Tag|Select ... OO: OO_LVCHANGE IO: --ignoreskippedcluster ID: lvchange_syncaction DESC: Resynchronize or check a raid LV. RULE: all not LV_raid0 lvchange --rebuild PV VG|LV_raid|Tag|Select ... OO: OO_LVCHANGE IO: --ignoreskippedcluster ID: lvchange_rebuild DESC: Reconstruct data on specific PVs of a raid LV. RULE: all not LV_raid0 lvchange --activate Active VG|LV|Tag|Select ... OO: --activationmode ActivationMode, --partial, --poll Bool, --monitor Bool, --ignoreactivationskip, --ignorelockingfailure, --sysinit, --readonly, OO_LVCHANGE IO: --ignoreskippedcluster ID: lvchange_activate DESC: Activate or deactivate an LV. lvchange --refresh VG|LV|Tag|Select ... OO: --activationmode ActivationMode, --partial, --poll Bool, --monitor Bool, OO_LVCHANGE IO: --ignoreskippedcluster ID: lvchange_refresh DESC: Reactivate an LV using the latest metadata. lvchange --monitor Bool VG|LV|Tag|Select ... OO: OO_LVCHANGE IO: --ignoreskippedcluster ID: lvchange_monitor DESC: Start or stop monitoring an LV from dmeventd. RULE: all not lv_is_pvmove lvchange --poll Bool VG|LV|Tag|Select ... OO: --monitor Bool, OO_LVCHANGE IO: --ignoreskippedcluster ID: lvchange_poll DESC: Start or stop processing an LV conversion. lvchange --persistent y --minor Number LV OO: --major Number, --activate Active, --poll Bool, --monitor Bool, OO_LVCHANGE IO: --ignoreskippedcluster ID: lvchange_persistent DESC: Make the minor device number persistent for an LV. RULE: all not LV_thinpool LV_cachepool LV_vdopool OO_LVCONVERT_POOL: --poolmetadata LV, --poolmetadatasize SizeMB, --poolmetadataspare Bool, --readahead Readahead, --chunksize SizeKB, --zero Bool, --metadataprofile String OO_LVCONVERT_THINPOOL: --discards Discards, --errorwhenfull Bool OO_LVCONVERT_CACHE: --cachemetadataformat CacheMetadataFormat, --cachemode CacheMode, --cachepolicy String, --cachesettings String, --zero Bool OO_LVCONVERT_VDO: --metadataprofile String, --readahead Readahead, --compression Bool, --deduplication Bool, --vdosettings String, --zero Bool OO_LVCONVERT: --alloc Alloc, --background, --force, --noudevsync lvconvert --type linear LV OO: OO_LVCONVERT OP: PV ... ID: lvconvert_raid_types DESC: Convert LV to linear. RULE: all not lv_is_locked lv_is_pvmove lvconvert --type striped LV OO: --stripes_long Number, --stripesize SizeKB, --regionsize RegionSize, --interval Number, OO_LVCONVERT OP: PV ... ID: lvconvert_raid_types DESC: Convert LV to striped. RULE: all not lv_is_locked lv_is_pvmove lvconvert --type mirror LV OO: --mirrors SNumber, --stripes_long Number, --stripesize SizeKB, --regionsize RegionSize, --interval Number, --mirrorlog MirrorLog, OO_LVCONVERT OP: PV ... ID: lvconvert_raid_types DESC: Convert LV to type mirror (also see type raid1), RULE: all not lv_is_locked lv_is_pvmove lvconvert --type raid LV OO: --mirrors SNumber, --stripes_long Number, --stripesize SizeKB, --regionsize RegionSize, --interval Number, OO_LVCONVERT OP: PV ... ID: lvconvert_raid_types DESC: Convert LV to raid or change raid layout DESC: (a specific raid level must be used, e.g. raid1). RULE: all not lv_is_locked lv_is_pvmove RULE: lv_is_raid_with_integrity not --stripes_long --stripesize --regionsize --interval lvconvert --mirrors SNumber LV OO: --regionsize RegionSize, --interval Number, --mirrorlog MirrorLog, OO_LVCONVERT OP: PV ... ID: lvconvert_raid_types DESC: Convert LV to raid1 or mirror, or change number of mirror images. RULE: all not lv_is_locked lv_is_pvmove lvconvert --stripes_long Number LV_raid OO: OO_LVCONVERT, --interval Number, --regionsize RegionSize, --stripesize SizeKB OP: PV ... ID: lvconvert_raid_types DESC: Convert raid LV to change number of stripe images. RULE: all not lv_is_locked lv_is_pvmove lv_is_raid_with_integrity RULE: all not LV_raid0 LV_raid1 lvconvert --stripesize SizeKB LV_raid OO: OO_LVCONVERT, --interval Number, --regionsize RegionSize ID: lvconvert_raid_types DESC: Convert raid LV to change the stripe size. RULE: all not lv_is_locked lv_is_pvmove lv_is_raid_with_integrity RULE: all not LV_raid0 LV_raid1 lvconvert --regionsize RegionSize LV_raid OO: OO_LVCONVERT ID: lvconvert_change_region_size DESC: Change the region size of an LV. RULE: all not lv_is_locked lv_is_pvmove lv_is_raid_with_integrity RULE: all not LV_raid0 FLAGS: SECONDARY_SYNTAX lvconvert --splitmirrors Number --name LV_new LV_raid1_mirror_cache OO: OO_LVCONVERT OP: PV ... ID: lvconvert_split_mirror_images DESC: Split images from a raid1 or mirror LV and use them to create a new LV. RULE: all not lv_is_locked lv_is_pvmove lv_is_raid_with_integrity lvconvert --splitmirrors Number --trackchanges LV_raid1_cache OO: OO_LVCONVERT OP: PV ... ID: lvconvert_split_mirror_images DESC: Split images from a raid1 LV and track changes to origin for later merge. RULE: all not lv_is_locked lv_is_pvmove lv_is_raid_with_integrity lvconvert --mergemirrors LV_linear_raid|VG|Tag ... OO: OO_LVCONVERT ID: lvconvert_merge_mirror_images DESC: Merge LV images that were split from a raid1 LV. RULE: all not lv_is_locked lv_is_pvmove lv_is_merging_origin lv_is_virtual_origin lv_is_external_origin lv_is_merging_cow lv_is_raid_with_integrity lvconvert --mirrorlog MirrorLog LV_mirror OO: OO_LVCONVERT OP: PV ... ID: lvconvert_change_mirrorlog DESC: Change the type of mirror log used by a mirror LV. RULE: all not lv_is_locked lv_is_pvmove FLAGS: SECONDARY_SYNTAX lvconvert --type thin --thinpool LV LV_linear_striped_raid_cache_thin_error_zero OO: --thin, --originname LV_new, OO_LVCONVERT_POOL, OO_LVCONVERT ID: lvconvert_to_thin_with_external DESC: Convert LV to a thin LV, using the original LV as an external origin. RULE: all and lv_is_visible RULE: all not lv_is_locked lv_is_raid_with_integrity RULE: --poolmetadata not --readahead --stripesize --stripes_long lvconvert --thin --thinpool LV LV_linear_striped_raid_cache_thin_error_zero OO: --originname LV_new, OO_LVCONVERT_POOL, OO_LVCONVERT ID: lvconvert_to_thin_with_external DESC: Convert LV to a thin LV, using the original LV as an external origin. FLAGS: SECONDARY_SYNTAX AUTOTYPE: thin RULE: all and lv_is_visible RULE: all not lv_is_locked lv_is_raid_with_integrity RULE: --poolmetadata not --readahead --stripesize --stripes_long lvconvert --type cache --cachepool LV LV_linear_striped_raid_thinpool_vdo_vdopool_vdopooldata OO: --cache, OO_LVCONVERT_CACHE, OO_LVCONVERT_POOL, OO_LVCONVERT ID: lvconvert_to_cache_with_cachepool DESC: Attach a cache pool to an LV, converts the LV to type cache. RULE: all and lv_is_visible RULE: all not lv_is_raid_with_integrity RULE: --poolmetadata not --readahead --stripesize --stripes_long lvconvert --cache --cachepool LV LV_linear_striped_raid_thinpool_vdo_vdopool_vdopooldata OO: OO_LVCONVERT_CACHE, OO_LVCONVERT_POOL, OO_LVCONVERT ID: lvconvert_to_cache_with_cachepool DESC: Attach a cache pool to an LV. RULE: all and lv_is_visible RULE: all not lv_is_raid_with_integrity RULE: --poolmetadata not --readahead --stripesize --stripes_long FLAGS: SECONDARY_SYNTAX AUTOTYPE: cache lvconvert --type writecache --cachevol LV LV_linear_striped_raid_thinpool OO: OO_LVCONVERT, --cachesettings String ID: lvconvert_to_writecache DESC: Attach a writecache to an LV, converts the LV to type writecache. RULE: all and lv_is_visible RULE: all not lv_is_raid_with_integrity lvconvert --type cache --cachevol LV LV_linear_striped_raid_thinpool OO: --cache, OO_LVCONVERT_CACHE, OO_LVCONVERT, --poolmetadatasize SizeMB, --chunksize SizeKB ID: lvconvert_to_cache_with_cachevol DESC: Attach a cache to an LV, converts the LV to type cache. RULE: all and lv_is_visible RULE: all not lv_is_raid_with_integrity lvconvert --cache --cachevol LV LV_linear_striped_raid_thinpool OO: OO_LVCONVERT_CACHE, OO_LVCONVERT, --poolmetadatasize SizeMB, --chunksize SizeKB ID: lvconvert_to_cache_with_cachevol DESC: Attach a cache to an LV, converts the LV to type cache. RULE: all and lv_is_visible RULE: all not lv_is_raid_with_integrity FLAGS: SECONDARY_SYNTAX lvconvert --type writecache --cachedevice PV LV_linear_striped_raid_thinpool OO: OO_LVCONVERT, --cachesize SizeMB, --cachesettings String ID: lvconvert_to_writecache_with_device DESC: Add a writecache to an LV, using a specified cache device. RULE: all and lv_is_visible lvconvert --type cache --cachedevice PV LV_linear_striped_raid_thinpool OO: OO_LVCONVERT, --cachesize SizeMB, --cachesettings String, --chunksize SizeKB ID: lvconvert_to_cache_with_device DESC: Add a cache to an LV, using a specified cache device. RULE: all and lv_is_visible lvconvert --type thin-pool LV_linear_striped_raid_cache_writecache_error_zero OO: --stripes_long Number, --stripesize SizeKB, OO_LVCONVERT_THINPOOL, OO_LVCONVERT_POOL, OO_LVCONVERT OP: PV ... ID: lvconvert_to_thinpool DESC: Convert LV to type thin-pool. RULE: all and lv_is_visible RULE: all not lv_is_locked lv_is_origin lv_is_merging_origin lv_is_external_origin lv_is_virtual lv_is_raid_with_integrity RULE: --poolmetadata not --readahead --stripesize --stripes_long lvconvert --thinpool LV_linear_striped_raid_cache_writecache_thinpool OO: --stripes_long Number, --stripesize SizeKB, OO_LVCONVERT_THINPOOL, OO_LVCONVERT_POOL, OO_LVCONVERT OP: PV ... ID: lvconvert_to_thinpool_or_swap_metadata DESC: Convert LV to type thin-pool (variant, use --type thin-pool). DESC: Swap metadata LV in a thin pool (variant, use --swapmetadata). FLAGS: PREVIOUS_SYNTAX RULE: all and lv_is_visible RULE: all not lv_is_raid_with_integrity RULE: --poolmetadata not --readahead --stripesize --stripes_long AUTOTYPE: thin-pool lvconvert --type cache-pool LV_linear_striped_raid OO: OO_LVCONVERT_CACHE, OO_LVCONVERT_POOL, OO_LVCONVERT OP: PV ... ID: lvconvert_to_cachepool DESC: Convert LV to type cache-pool. RULE: --poolmetadata not --readahead --stripesize --stripes_long RULE: all not lv_is_raid_with_integrity lvconvert --cachepool LV_linear_striped_raid_cachepool_error_zero OO: --type cache-pool, OO_LVCONVERT_CACHE, OO_LVCONVERT_POOL, OO_LVCONVERT OP: PV ... ID: lvconvert_to_cachepool_or_swap_metadata DESC: Convert LV to type cache-pool (variant, use --type cache-pool). DESC: Swap metadata LV in a cache pool (variant, use --swapmetadata). FLAGS: PREVIOUS_SYNTAX RULE: all and lv_is_visible RULE: all not lv_is_raid_with_integrity RULE: --poolmetadata not --readahead --stripesize --stripes_long lvconvert --type vdo-pool LV_linear_striped_raid_cache OO: --name LV_new, --virtualsize SizeMB, OO_LVCONVERT_VDO, OO_LVCONVERT ID: lvconvert_to_vdopool DESC: Convert LV to type vdopool. RULE: all and lv_is_visible RULE: all not lv_is_locked lv_is_origin lv_is_merging_origin lv_is_external_origin lv_is_virtual lv_is_raid_with_integrity lvconvert --vdopool LV_linear_striped_raid_cache OO: OO_LVCONVERT_VDO, OO_LVCONVERT, --name LV_new, --virtualsize SizeMB, ID: lvconvert_to_vdopool_param DESC: Convert LV to type vdopool. RULE: all and lv_is_visible RULE: all not lv_is_locked lv_is_origin lv_is_merging_origin lv_is_external_origin lv_is_virtual lv_is_raid_with_integrity FLAGS: SECONDARY_SYNTAX AUTOTYPE: vdo-pool lvconvert --splitcache LV_cachepool_cache_thinpool_vdopool_writecache OO: OO_LVCONVERT, --cachesettings String ID: lvconvert_split_and_keep_cache DESC: Detach a cache from an LV. lvconvert --uncache LV_cache_thinpool_vdopool_writecache OO: OO_LVCONVERT, --cachesettings String ID: lvconvert_split_and_remove_cache DESC: Detach and delete a cache from an LV. FLAGS: SECONDARY_SYNTAX lvconvert --swapmetadata --poolmetadata LV LV_thinpool_cachepool OO: --chunksize SizeKB, OO_LVCONVERT ID: lvconvert_swap_pool_metadata DESC: Swap metadata LV in a thin pool or cache pool (for repair only). FLAGS: SECONDARY_SYNTAX lvconvert --merge LV_linear_striped_raid_thin_snapshot|VG|Tag ... OO: --background, --interval Number, OO_LVCONVERT ID: lvconvert_merge DESC: Merge LV that was split from a mirror (variant, use --mergemirrors). DESC: Merge thin LV into its origin LV (variant, use --mergethin). DESC: Merge COW snapshot LV into its origin (variant, use --mergesnapshot). RULE: all not lv_is_locked lv_is_pvmove lv_is_merging_origin lv_is_virtual_origin lv_is_external_origin lv_is_merging_cow FLAGS: SECONDARY_SYNTAX lvconvert --mergethin LV_thin ... OO: OO_LVCONVERT ID: lvconvert_merge_thin DESC: Merge thin LV into its origin LV. RULE: all not lv_is_locked lv_is_pvmove lv_is_merging_origin lv_is_virtual_origin lv_is_external_origin lv_is_merging_cow RULE: all and lv_is_visible lvconvert --mergesnapshot LV_snapshot ... OO: --background, --interval Number, OO_LVCONVERT ID: lvconvert_merge_snapshot DESC: Merge COW snapshot LV into its origin. RULE: all not lv_is_locked lv_is_pvmove lv_is_merging_origin lv_is_virtual_origin lv_is_external_origin lv_is_merging_cow RULE: all and lv_is_visible lvconvert --splitsnapshot LV_snapshot OO: OO_LVCONVERT ID: lvconvert_split_cow_snapshot DESC: Separate a COW snapshot from its origin LV. RULE: all not lv_is_locked lv_is_pvmove lv_is_origin lv_is_external_origin lv_is_merging_cow FLAGS: SECONDARY_SYNTAX lvconvert --type snapshot LV LV_linear_striped OO: --snapshot, --chunksize SizeKB, --zero Bool, OO_LVCONVERT ID: lvconvert_combine_split_snapshot DESC: Combine a former COW snapshot (second arg) with a former DESC: origin LV (first arg) to reverse a splitsnapshot command. RULE: all not lv_is_locked lv_is_pvmove RULE: all and lv_is_visible lvconvert --snapshot LV LV_linear_striped OO: --chunksize SizeKB, --zero Bool, OO_LVCONVERT ID: lvconvert_combine_split_snapshot DESC: Combine a former COW snapshot (second arg) with a former DESC: origin LV (first arg) to reverse a splitsnapshot command. RULE: all not lv_is_locked lv_is_pvmove RULE: all and lv_is_visible FLAGS: SECONDARY_SYNTAX AUTOTYPE: snapshot lvconvert --repair LV_cache_cachepool_mirror_raid_thinpool OO: --usepolicies, --interval Number, --poolmetadataspare Bool, OO_LVCONVERT OP: PV ... ID: lvconvert_repair DESC: Replace failed PVs in a raid or mirror LV. DESC: Repair a thin pool. DESC: Repair a cache pool. RULE: all not lv_is_locked lv_is_pvmove RULE: --poolmetadataspare and LV_cache LV_cachepool LV_thinpool lvconvert --replace PV LV_raid OO: OO_LVCONVERT OP: PV ... ID: lvconvert_replace_pv DESC: Replace specific PV(s) in a raid LV with another PV. RULE: all not lv_is_locked lv_is_pvmove lvconvert --startpoll LV_mirror_raid OO: OO_LVCONVERT ID: lvconvert_start_poll DESC: Poll LV to continue conversion. RULE: all and lv_is_converting lvconvert LV_mirror_raid OO: OO_LVCONVERT ID: lvconvert_plain DESC: Poll LV to continue conversion (also see --startpoll) DESC: or waits till conversion/mirror syncing is finished FLAGS: SECONDARY_SYNTAX lvconvert --raidintegrity Bool LV_raid OO: --raidintegritymode String, --raidintegrityblocksize Number, OO_LVCONVERT OP: PV ... ID: lvconvert_integrity DESC: Add or remove data integrity checksums to raid images. OO_LVCREATE: --addtag Tag, --alloc Alloc, --autobackup Bool, --activate Active, --contiguous Bool, --ignoreactivationskip, --ignoremonitoring, --major Number, --metadataprofile String, --minor Number, --monitor Bool, --name String, --nosync, --noudevsync, --permission Permission, --persistent Bool, --readahead Readahead, --reportformat ReportFmt, --setactivationskip Bool, --wipesignatures Bool, --zero Bool, --setautoactivation Bool OO_LVCREATE_CACHE: --cachemode CacheMode, --cachepolicy String, --cachesettings String, --chunksize SizeKB, --cachemetadataformat CacheMetadataFormat OO_LVCREATE_POOL: --poolmetadatasize SizeMB, --poolmetadataspare Bool, --chunksize SizeKB OO_LVCREATE_THINPOOL: --discards Discards, --errorwhenfull Bool OO_LVCREATE_VDO: --compression Bool, --deduplication Bool, --vdosettings String lvcreate --type error --size SizeMB VG OO: OO_LVCREATE ID: lvcreate_error_vol DESC: Create an LV that returns errors when used. FLAGS: SECONDARY_SYNTAX lvcreate --type zero --size SizeMB VG OO: OO_LVCREATE ID: lvcreate_zero_vol DESC: Create an LV that returns zeros when read. FLAGS: SECONDARY_SYNTAX lvcreate --type linear --size SizeMB VG OO: OO_LVCREATE OP: PV ... IO: --mirrors 0, --stripes 1 ID: lvcreate_linear DESC: Create a linear LV. FLAGS: SECONDARY_SYNTAX lvcreate --size SizeMB VG OO: OO_LVCREATE OP: PV ... IO: --mirrors 0, --stripes 1 ID: lvcreate_linear DESC: Create a linear LV. AUTOTYPE: linear lvcreate --type striped --size SizeMB VG OO: --stripes Number, --stripesize SizeKB, OO_LVCREATE OP: PV ... ID: lvcreate_striped DESC: Create a striped LV (also see lvcreate --stripes). FLAGS: SECONDARY_SYNTAX lvcreate --stripes Number --size SizeMB VG OO: --stripesize SizeKB, OO_LVCREATE OP: PV ... ID: lvcreate_striped DESC: Create a striped LV. AUTOTYPE: striped lvcreate --type mirror --size SizeMB VG OO: --stripes Number, --stripesize SizeKB, --mirrors PNumber, --mirrorlog MirrorLog, --regionsize RegionSize, OO_LVCREATE OP: PV ... ID: lvcreate_mirror DESC: Create a mirror LV (also see --type raid1). FLAGS: SECONDARY_SYNTAX lvcreate --mirrors PNumber --size SizeMB VG OO: --stripesize SizeKB, --mirrorlog MirrorLog, --regionsize RegionSize, --minrecoveryrate SizeKB, --maxrecoveryrate SizeKB, OO_LVCREATE OP: PV ... IO: --stripes 1 ID: lvcreate_mirror_or_raid1 DESC: Create a raid1 or mirror LV. AUTOTYPE: raid1 AUTOTYPE: mirror lvcreate --type raid --size SizeMB VG OO: --stripes Number, --stripesize SizeKB, --mirrors PNumber, --regionsize RegionSize, --minrecoveryrate SizeKB, --maxrecoveryrate SizeKB, --raidintegrity Bool, --raidintegritymode String, --raidintegrityblocksize Number, OO_LVCREATE OP: PV ... ID: lvcreate_raid_any DESC: Create a raid LV (a specific raid level must be used, e.g. raid1). lvcreate --mirrors PNumber --stripes Number --size SizeMB VG OO: --stripesize SizeKB, --regionsize RegionSize, --minrecoveryrate SizeKB, --maxrecoveryrate SizeKB, OO_LVCREATE OP: PV ... ID: lvcreate_raid_any DESC: Create a raid10 LV. AUTOTYPE: raid10 lvcreate --type snapshot --size SizeMB LV OO: --snapshot, --stripes Number, --stripesize SizeKB, --chunksize SizeKB, OO_LVCREATE OP: PV ... ID: lvcreate_cow_snapshot DESC: Create a COW snapshot LV of an origin LV DESC: (also see --snapshot). FLAGS: SECONDARY_SYNTAX lvcreate --snapshot --size SizeMB LV OO: --stripes Number, --stripesize SizeKB, --chunksize SizeKB, OO_LVCREATE OP: PV ... ID: lvcreate_cow_snapshot DESC: Create a COW snapshot LV of an origin LV. AUTOTYPE: snapshot lvcreate --type snapshot --size SizeMB --virtualsize SizeMB VG OO: --snapshot, --chunksize SizeKB, OO_LVCREATE OP: PV ... ID: lvcreate_cow_snapshot_with_virtual_origin DESC: Create a sparse COW snapshot LV of a virtual origin LV DESC: (also see --snapshot). FLAGS: SECONDARY_SYNTAX lvcreate --type thin-pool --size SizeMB VG OO: --thinpool LV_new, --stripes Number, --stripesize SizeKB, --thin, OO_LVCREATE_THINPOOL, OO_LVCREATE_POOL, OO_LVCREATE OP: PV ... IO: --mirrors 0 ID: lvcreate_thinpool DESC: Create a thin pool. lvcreate --thin --size SizeMB VG OO: --stripes Number, --stripesize SizeKB, OO_LVCREATE_THINPOOL, OO_LVCREATE_POOL, OO_LVCREATE OP: PV ... IO: --mirrors 0 ID: lvcreate_thinpool DESC: Create a thin pool. FLAGS: SECONDARY_SYNTAX AUTOTYPE: thin-pool lvcreate --size SizeMB --thinpool LV_new VG OO: --stripes Number, --stripesize SizeKB, --thin, OO_LVCREATE_THINPOOL, OO_LVCREATE_POOL, OO_LVCREATE OP: PV ... IO: --mirrors 0 ID: lvcreate_thinpool DESC: Create a thin pool named in --thinpool. FLAGS: SECONDARY_SYNTAX AUTOTYPE: thin-pool lvcreate --type cache-pool --size SizeMB VG OO: --stripes Number, --stripesize SizeKB, --cache, OO_LVCREATE_CACHE, OO_LVCREATE_POOL, OO_LVCREATE OP: PV ... ID: lvcreate_cachepool DESC: Create a cache pool. lvcreate --type cache-pool --size SizeMB --cachepool LV_new VG OO: --stripes Number, --stripesize SizeKB, --cache, OO_LVCREATE_CACHE, OO_LVCREATE_POOL, OO_LVCREATE OP: PV ... ID: lvcreate_cachepool DESC: Create a cache pool named by the --cachepool arg DESC: (variant, uses --cachepool in place of --name). FLAGS: SECONDARY_SYNTAX lvcreate --type thin --virtualsize SizeMB --thinpool LV_thinpool VG OO: --thin, OO_LVCREATE IO: --mirrors 0 ID: lvcreate_thin_vol DESC: Create a thin LV in a thin pool. FLAGS: SECONDARY_SYNTAX lvcreate --type thin --virtualsize SizeMB LV_thinpool OO: --thin, OO_LVCREATE IO: --mirrors 0 ID: lvcreate_thin_vol DESC: Create a thin LV in a thin pool named in the first arg DESC: (variant, also see --thinpool for naming pool). FLAGS: SECONDARY_SYNTAX lvcreate --virtualsize SizeMB --thinpool LV_thinpool VG OO: --thin, OO_LVCREATE IO: --mirrors 0 ID: lvcreate_thin_vol DESC: Create a thin LV in a thin pool. AUTOTYPE: thin lvcreate --virtualsize SizeMB LV_thinpool OO: --thin, OO_LVCREATE IO: --mirrors 0 ID: lvcreate_thin_vol DESC: Create a thin LV in the thin pool named in the first arg DESC: (also see --thinpool for naming pool.) FLAGS: SECONDARY_SYNTAX AUTOTYPE: thin lvcreate --type thin LV_thin OO: --thin, OO_LVCREATE IO: --mirrors 0 ID: lvcreate_thin_snapshot DESC: Create a thin LV that is a snapshot of an existing thin LV. FLAGS: SECONDARY_SYNTAX lvcreate --thin LV_thin OO: OO_LVCREATE IO: --mirrors 0 ID: lvcreate_thin_snapshot DESC: Create a thin LV that is a snapshot of an existing thin LV. FLAGS: SECONDARY_SYNTAX AUTOTYPE: thin lvcreate --snapshot LV_thin OO: OO_LVCREATE IO: --mirrors 0 ID: lvcreate_thin_snapshot DESC: Create a thin LV that is a snapshot of an existing thin LV. AUTOTYPE: thin lvcreate --type thin --thinpool LV_thinpool LV OO: --thin, OO_LVCREATE IO: --mirrors 0 ID: lvcreate_thin_snapshot_of_external DESC: Create a thin LV that is a snapshot of an external origin LV. lvcreate --snapshot --thinpool LV_thinpool LV OO: OO_LVCREATE IO: --mirrors 0 ID: lvcreate_thin_snapshot_of_external DESC: Create a thin LV that is a snapshot of an external origin LV. FLAGS: SECONDARY_SYNTAX AUTOTYPE: thin lvcreate --type vdo --size SizeMB VG OO: --stripes Number, --stripesize SizeKB, --vdo, --virtualsize SizeMB, --vdopool LV_new, OO_LVCREATE_VDO, OO_LVCREATE OP: PV ... IO: --mirrors 0 ID: lvcreate_vdo_vol DESC: Create a LV that returns VDO when used. lvcreate --vdo --size SizeMB VG OO: --stripes Number, --stripesize SizeKB, --virtualsize SizeMB, --vdopool LV_new, OO_LVCREATE_VDO, OO_LVCREATE OP: PV ... IO: --mirrors 0 ID: lvcreate_vdo_vol DESC: Create a VDO LV with VDO pool. FLAGS: SECONDARY_SYNTAX AUTOTYPE: vdo lvcreate --vdopool LV_new --size SizeMB VG OO: --stripes Number, --stripesize SizeKB, --virtualsize SizeMB, OO_LVCREATE_VDO, OO_LVCREATE OP: PV ... IO: --mirrors 0 ID: lvcreate_vdo_vol DESC: Create a VDO LV with VDO pool. FLAGS: SECONDARY_SYNTAX AUTOTYPE: vdo lvcreate --type thin --virtualsize SizeMB --size SizeMB --thinpool LV_new VG OO: --stripes Number, --stripesize SizeKB, --thin, OO_LVCREATE_THINPOOL, OO_LVCREATE_POOL, OO_LVCREATE OP: PV ... IO: --mirrors 0 ID: lvcreate_thin_vol_and_thinpool DESC: Create a thin LV, first creating a thin pool for it, DESC: where the new thin pool is named by the --thinpool arg. FLAGS: SECONDARY_SYNTAX lvcreate --virtualsize SizeMB --size SizeMB --thinpool LV_new VG OO: --stripes Number, --stripesize SizeKB, --thin, OO_LVCREATE_THINPOOL, OO_LVCREATE_POOL, OO_LVCREATE OP: PV ... IO: --mirrors 0 ID: lvcreate_thin_vol_and_thinpool DESC: Create a thin LV, first creating a thin pool for it, DESC: where the new thin pool is named by --thinpool. FLAGS: SECONDARY_SYNTAX AUTOTYPE: thin lvcreate --type thin --virtualsize SizeMB --size SizeMB LV_new|VG OO: --stripes Number, --stripesize SizeKB, --thin, OO_LVCREATE_THINPOOL, OO_LVCREATE_POOL, OO_LVCREATE OP: PV ... IO: --mirrors 0 ID: lvcreate_thin_vol_and_thinpool DESC: Create a thin LV, first creating a thin pool for it, DESC: where the new thin pool is named in the first arg, DESC: or the new thin pool name is generated when the first DESC: arg is a VG name. FLAGS: SECONDARY_SYNTAX lvcreate --thin --virtualsize SizeMB --size SizeMB LV_new|VG OO: --stripes Number, --stripesize SizeKB, OO_LVCREATE_THINPOOL, OO_LVCREATE_POOL, OO_LVCREATE OP: PV ... IO: --mirrors 0 ID: lvcreate_thin_vol_and_thinpool DESC: Create a thin LV, first creating a thin pool for it, DESC: where the new thin pool is named in the first arg, DESC: or the new thin pool name is generated when the first DESC: arg is a VG name. FLAGS: SECONDARY_SYNTAX AUTOTYPE: thin lvcreate --size SizeMB --virtualsize SizeMB VG OO: --stripes Number, --stripesize SizeKB, --snapshot, --thin, OO_LVCREATE_THINPOOL, OO_LVCREATE_POOL, OO_LVCREATE OP: PV ... IO: --mirrors 0 ID: lvcreate_thin_vol_with_thinpool_or_sparse_snapshot DESC: Create a thin LV, first creating a thin pool for it. DESC: Create a sparse snapshot of a virtual origin LV DESC: Chooses type thin or snapshot according to DESC: config setting sparse_segtype_default. FLAGS: SECONDARY_SYNTAX AUTOTYPE: thin AUTOTYPE: snapshot lvcreate --type cache --size SizeMB --cachepool LV_cachepool VG OO: --stripes Number, --stripesize SizeKB, --cache, OO_LVCREATE_CACHE, OO_LVCREATE_POOL, OO_LVCREATE OP: PV ... ID: lvcreate_and_attach_cachepool DESC: Create a new LV, then attach the specified cachepool DESC: which converts the new LV to type cache. lvcreate --size SizeMB --cachepool LV_cachepool VG OO: --stripes Number, --stripesize SizeKB, --cache, OO_LVCREATE_CACHE, OO_LVCREATE OP: PV ... ID: lvcreate_and_attach_cachepool_v2 DESC: Create a new LV, then attach the specified cachepool DESC: which converts the new LV to type cache. FLAGS: SECONDARY_SYNTAX AUTOTYPE: cache lvcreate --type cache --size SizeMB LV_cachepool OO: --stripes Number, --stripesize SizeKB, --cache, OO_LVCREATE_CACHE, OO_LVCREATE_POOL, OO_LVCREATE OP: PV ... ID: lvcreate_and_attach_cachepool_v3 DESC: Create a new LV, then attach the specified cachepool DESC: which converts the new LV to type cache. DESC: (variant, also use --cachepool). FLAGS: SECONDARY_SYNTAX lvcreate --cache --size SizeMB LV OO: OO_LVCREATE_CACHE, OO_LVCREATE_POOL, OO_LVCREATE, --stripes Number, --stripesize SizeKB OP: PV ... ID: lvcreate_new_plus_old_cachepool_or_lvconvert_old_plus_new_cachepool DESC: When the LV arg is a cachepool, then create a new LV and DESC: attach the cachepool arg to it. DESC: (variant, use --type cache and --cachepool.) DESC: When the LV arg is not a cachepool, then create a new cachepool DESC: and attach it to the LV arg (alternative, use lvconvert.) FLAGS: SECONDARY_SYNTAX AUTOTYPE: cache lvcreate --type cache --size SizeMB --cachevol LV VG OO: --stripes Number, --stripesize SizeKB, OO_LVCREATE_CACHE, OO_LVCREATE OP: PV ... ID: lvcreate_and_attach_cachevol_for_cache DESC: Create a new LV, then attach the specified cachevol DESC: which converts the new LV to type cache. lvcreate --type cache --size SizeMB --cachedevice PV VG OO: --stripes Number, --stripesize SizeKB, --cachesize SizeMB, OO_LVCREATE_CACHE, OO_LVCREATE OP: PV ... ID: lvcreate_and_attach_cachedevice_for_cache DESC: Create a new LV, then attach a cachevol created from DESC: the specified cache device, which converts the DESC: new LV to type cache. lvcreate --type writecache --size SizeMB --cachevol LV VG OO: OO_LVCREATE, --cachesettings String, --stripes Number, --stripesize SizeKB OP: PV ... ID: lvcreate_and_attach_cachevol_for_writecache DESC: Create a new LV, then attach the specified cachevol DESC: which converts the new LV to type writecache. lvcreate --type writecache --size SizeMB --cachedevice PV VG OO: OO_LVCREATE, --cachesize SizeMB, --cachesettings String, --stripes Number, --stripesize SizeKB OP: PV ... ID: lvcreate_and_attach_cachedevice_for_writecache DESC: Create a new LV, then attach a cachevol created from DESC: the specified cache device, which converts the DESC: new LV to type writecache. lvdisplay OO: --aligned, --all, --binary, --colon, --columns, --configreport ConfigReport, --foreign, --history, --ignorelockingfailure, --logonly, --maps, --noheadings, --nosuffix, --options String, --sort String, --readonly, --segments, --select String, --separator String, --shared, --unbuffered, --units Units OP: VG|LV|Tag ... IO: --partial, --ignoreskippedcluster, --reportformat ReportFmt ID: lvdisplay_general lvextend --size PSizeMB LV OO: --alloc Alloc, --autobackup Bool, --force, --mirrors Number, --nofsck, --nosync, --noudevsync, --reportformat ReportFmt, --resizefs, --stripes Number, --stripesize SizeKB, --poolmetadatasize PSizeMB, --type SegType OP: PV ... ID: lvextend_by_size DESC: Extend an LV by a specified size. lvextend LV PV ... OO: --alloc Alloc, --autobackup Bool, --force, --mirrors Number, --nofsck, --nosync, --noudevsync, --reportformat ReportFmt, --resizefs, --stripes Number, --stripesize SizeKB, --type SegType ID: lvextend_by_pv DESC: Extend an LV by specified PV extents. lvextend --poolmetadatasize PSizeMB LV_thinpool OO: --alloc Alloc, --autobackup Bool, --force, --mirrors Number, --nofsck, --nosync, --noudevsync, --reportformat ReportFmt, --stripes Number, --stripesize SizeKB, --type SegType OP: PV ... ID: lvextend_pool_metadata_by_size DESC: Extend a pool metadata SubLV by a specified size. lvextend --usepolicies LV_thinpool_snapshot OO: --alloc Alloc, --autobackup Bool, --force, --mirrors Number, --nofsck, --nosync, --noudevsync, --reportformat ReportFmt, --resizefs, --type SegType OP: PV ... ID: lvextend_by_policy DESC: Extend an LV according to a predefined policy. lvmconfig OO: OO_CONFIG OP: String ... ID: lvmconfig_general lvmdevices ID: lvmdevices_list DESC: Print devices in the devices file. lvmdevices --check ID: lvmdevices_check DESC: Check the devices file and report incorrect values. lvmdevices --update ID: lvmdevices_update DESC: Update the devices file to fix incorrect values. lvmdevices --adddev PV OO: --deviceidtype String ID: lvmdevices_edit DESC: Add a device to the devices file. lvmdevices --deldev PV ID: lvmdevices_edit DESC: Remove a device from the devices file. lvmdevices --addpvid String OO: --deviceidtype String ID: lvmdevices_edit DESC: Find the device with the given PVID and add it to the devices file. lvmdevices --delpvid String ID: lvmdevices_edit DESC: Remove the devices file entry for the given PVID. lvreduce --size NSizeMB LV OO: --autobackup Bool, --force, --nofsck, --noudevsync, --reportformat ReportFmt, --resizefs ID: lvreduce_general lvremove VG|LV|Tag|Select ... OO: --autobackup Bool, --force, --nohistory, --noudevsync, --reportformat ReportFmt, --select String ID: lvremove_general lvrename VG LV LV_new OO: --autobackup Bool, --noudevsync, --reportformat ReportFmt ID: lvrename_vg_lv_lv lvrename LV LV_new OO: --autobackup Bool, --noudevsync, --reportformat ReportFmt ID: lvrename_lv_lv lvresize --size SSizeMB LV OO: --alloc Alloc, --autobackup Bool, --force, --nofsck, --nosync, --noudevsync, --reportformat ReportFmt, --resizefs, --stripes Number, --stripesize SizeKB, --poolmetadatasize PSizeMB, --type SegType OP: PV ... ID: lvresize_by_size DESC: Resize an LV by a specified size. lvresize LV PV ... OO: --alloc Alloc, --autobackup Bool, --force, --nofsck, --nosync, --noudevsync, --reportformat ReportFmt, --resizefs, --stripes Number, --stripesize SizeKB, --type SegType ID: lvresize_by_pv DESC: Resize an LV by specified PV extents. lvresize --poolmetadatasize PSizeMB LV_thinpool OO: --alloc Alloc, --autobackup Bool, --force, --nofsck, --nosync, --noudevsync, --reportformat ReportFmt, --stripes Number, --stripesize SizeKB, --type SegType OP: PV ... ID: lvresize_pool_metadata_by_size DESC: Resize a pool metadata SubLV by a specified size. lvs OO: --history, --segments, OO_REPORT OP: VG|LV|Tag ... IO: --partial, --ignoreskippedcluster, --trustcache ID: lvs_general lvscan OO: --all, --blockdevice, --ignorelockingfailure, --readonly, --reportformat ReportFmt IO: --partial, --cache_long ID: lvscan_general OO_PVCHANGE: --autobackup Bool, --force, --reportformat ReportFmt, --uuid OO_PVCHANGE_META: --allocatable Bool, --addtag Tag, --deltag Tag, --uuid, --metadataignore Bool pvchange --all OO_PVCHANGE_META OO: OO_PVCHANGE IO: --ignoreskippedcluster ID: pvchange_properties_all DESC: Change properties of all PVs. pvchange OO_PVCHANGE_META PV|Select ... OO: --select String, OO_PVCHANGE IO: --ignoreskippedcluster ID: pvchange_properties_some DESC: Change properties of specified PVs. pvresize PV ... OO: --setphysicalvolumesize SizeMB, --reportformat ReportFmt ID: pvresize_general pvck PV ... OO: --labelsector Number ID: pvck_general DESC: Check for metadata on a device pvck --dump DumpType PV OO: --settings String, --file String, --pvmetadatacopies MetadataCopiesPV, --labelsector Number ID: pvck_dump DESC: Check and print LVM headers and metadata on a device pvck --repairtype RepairType PV OO: --settings String, --file String, --labelsector Number ID: pvck_repair_type DESC: Repair LVM headers or metadata on a device pvck --repair --file String PV OO: --settings String, --labelsector Number ID: pvck_repair DESC: Repair LVM headers and metadata on a device pvcreate PV ... OO: --dataalignment SizeKB, --dataalignmentoffset SizeKB, --bootloaderareasize SizeMB, --force, --labelsector Number, --metadatatype MetadataType, --pvmetadatacopies MetadataCopiesPV, --metadatasize SizeMB, --metadataignore Bool, --norestorefile, --setphysicalvolumesize SizeMB, --reportformat ReportFmt, --restorefile String, --uuidstr String, --zero Bool ID: pvcreate_general RULE: --norestorefile not --restorefile RULE: --bootloaderareasize not --restorefile pvdisplay OO: --aligned, --all, --binary, --colon, --columns, --configreport ConfigReport, --foreign, --ignorelockingfailure, --logonly, --maps, --noheadings, --nosuffix, --options String, --readonly, --select String, --separator String, --shared, --short, --sort String, --unbuffered, --units Units OP: PV|Tag ... IO: --ignoreskippedcluster, --reportformat ReportFmt ID: pvdisplay_general pvmove PV OO: --abort, --alloc Alloc, --atomic, --autobackup Bool, --background, --interval Number, --name LV, --noudevsync, --reportformat ReportFmt OP: PV ... ID: pvmove_one DESC: Move PV extents. pvmove OO: --abort, --background, --interval Number ID: pvmove_any DESC: Continue or abort existing pvmove operations. pvremove PV ... OO: --force, --reportformat ReportFmt ID: pvremove_general pvs OO: --segments, OO_REPORT OP: PV|Tag ... IO: --partial, --ignoreskippedcluster, --trustcache ID: pvs_general pvscan OO: --ignorelockingfailure, --reportformat ReportFmt, --exported, --novolumegroup, --short, --uuid ID: pvscan_display DESC: Display PV information. pvscan --cache_long OO: --ignorelockingfailure, --reportformat ReportFmt, --major Number, --minor Number, --noudevsync OP: PV|String ... IO: --background ID: pvscan_cache DESC: Record that a PV is online or offline. pvscan --cache_long --activate ay OO: --ignorelockingfailure, --reportformat ReportFmt, --major Number, --minor Number, --noudevsync OP: PV|String ... IO: --background ID: pvscan_cache DESC: Record that a PV is online and autoactivate the VG if complete. pvscan --cache_long --listvg PV OO: --ignorelockingfailure, --checkcomplete, --vgonline, --udevoutput ID: pvscan_cache DESC: Record that a PV is online and list the VG using the PV. pvscan --cache_long --listlvs PV OO: --ignorelockingfailure, --checkcomplete, --vgonline ID: pvscan_cache DESC: Record that a PV is online and list LVs using the PV. pvscan --listlvs PV ID: pvscan_cache DESC: List LVs using the PV. pvscan --listvg PV ID: pvscan_cache DESC: List the VG using the PV. vgcfgbackup OO: --file String, --foreign, --ignorelockingfailure, --readonly, --reportformat ReportFmt OP: VG ... IO: --partial ID: vgcfgbackup_general OO_VGCFGRESTORE: --force_long, --metadatatype MetadataType vgcfgrestore VG OO: OO_VGCFGRESTORE ID: vgcfgrestore_by_vg DESC: Restore VG metadata from last backup. vgcfgrestore --file String VG OO: OO_VGCFGRESTORE ID: vgcfgrestore_by_file DESC: Restore VG metadata from specified file. vgcfgrestore --list VG OO: OO_VGCFGRESTORE ID: vgcfgrestore_list_by_vg DESC: List all VG metadata backups. vgcfgrestore --list --file String OO: OO_VGCFGRESTORE OP: VG ID: vgcfgrestore_list_by_file DESC: List one VG metadata backup file. OO_VGCHANGE: --autobackup Bool, --ignoremonitoring, --noudevsync, --reportformat ReportFmt, --select String, --force OO_VGCHANGE_META: --addtag Tag, --deltag Tag, --logicalvolume Uint32, --maxphysicalvolumes Uint32, --alloc Alloc, --uuid, --pvmetadatacopies MetadataCopiesPV, --vgmetadatacopies MetadataCopiesVG, --physicalextentsize SizeMB, --resizeable Bool, --profile String, --detachprofile, --metadataprofile String, --setautoactivation Bool vgchange OO_VGCHANGE_META OO: --poll Bool, OO_VGCHANGE OP: VG|Tag|Select ... IO: --ignoreskippedcluster ID: vgchange_properties DESC: Change a general VG attribute. DESC: For options listed in parentheses, any one is DESC: required, after which the others are optional. vgchange --monitor Bool OO: --sysinit, --ignorelockingfailure, --poll Bool, OO_VGCHANGE OP: VG|Tag|Select ... IO: --ignoreskippedcluster ID: vgchange_monitor DESC: Start or stop monitoring LVs from dmeventd. vgchange --poll Bool OO: --ignorelockingfailure, OO_VGCHANGE OP: VG|Tag|Select ... IO: --ignoreskippedcluster ID: vgchange_poll DESC: Start or stop processing LV conversions. vgchange --activate Active OO: --activationmode ActivationMode, --ignoreactivationskip, --partial, --sysinit, --readonly, --ignorelockingfailure, --monitor Bool, --poll Bool, OO_VGCHANGE OP: VG|Tag|Select ... IO: --ignoreskippedcluster ID: vgchange_activate DESC: Activate or deactivate LVs. vgchange --refresh OO: --sysinit, --ignorelockingfailure, --poll Bool, OO_VGCHANGE OP: VG|Tag|Select ... IO: --ignoreskippedcluster ID: vgchange_refresh DESC: Reactivate LVs using the latest metadata. vgchange --systemid String VG ID: vgchange_systemid DESC: Change the system ID of a VG. vgchange --lockstart OO: --select String OP: VG|Tag|Select ... ID: vgchange_lockstart DESC: Start the lockspace of a shared VG in lvmlockd. vgchange --lockstop OO: --select String OP: VG|Tag|Select ... ID: vgchange_lockstop DESC: Stop the lockspace of a shared VG in lvmlockd. vgchange --locktype LockType VG ID: vgchange_locktype DESC: Change the lock type for a shared VG. vgck OO: --reportformat ReportFmt OP: VG|Tag ... ID: vgck_general DESC: Read and display information about a VG. vgck --updatemetadata VG ID: vgck_update_metadata DESC: Rewrite VG metadata to correct problems. vgcreate VG_new PV ... OO: --addtag Tag, --alloc Alloc, --autobackup Bool, --clustered Bool, --maxlogicalvolumes Uint32, --maxphysicalvolumes Uint32, --metadataprofile String, --metadatatype MetadataType, --physicalextentsize SizeMB, --force, --zero Bool, --labelsector Number, --metadatasize SizeMB, --pvmetadatacopies MetadataCopiesPV, --vgmetadatacopies MetadataCopiesVG, --reportformat ReportFmt, --dataalignment SizeKB, --dataalignmentoffset SizeKB, --shared, --systemid String, --locktype LockType, --setautoactivation Bool ID: vgcreate_general vgdisplay OO: --activevolumegroups, --aligned, --binary, --colon, --columns, --configreport ConfigReport, --foreign, --ignorelockingfailure, --logonly, --noheadings, --nosuffix, --options String, --readonly, --select String, --shared, --short, --separator String, --sort String, --unbuffered, --units Units OP: VG|Tag ... IO: --partial, --ignoreskippedcluster, --reportformat ReportFmt ID: vgdisplay_general OO_VGEXPORT: --reportformat ReportFmt vgexport VG|Tag|Select ... OO: --select String, OO_VGEXPORT ID: vgexport_some DESC: Export specified VGs. vgexport --all OO: OO_VGEXPORT ID: vgexport_all DESC: Export all VGs. vgextend VG PV ... OO: --autobackup Bool, --force, --zero Bool, --labelsector Number, --metadatatype MetadataType, --metadatasize SizeMB, --pvmetadatacopies MetadataCopiesPV, --metadataignore Bool, --dataalignment SizeKB, --dataalignmentoffset SizeKB, --reportformat ReportFmt, --restoremissing ID: vgextend_general OO_VGIMPORT: --force, --reportformat ReportFmt vgimport VG|Tag|Select ... OO: --select String, OO_VGIMPORT ID: vgimport_some DESC: Import specified VGs. vgimport --all OO: OO_VGIMPORT ID: vgimport_all DESC: Import all VGs. vgimportclone PV ... OO: --basevgname VG, --import, --importdevices ID: vgimportclone_general vgimportdevices VG|Tag|Select ... OO: --select String, --foreign, --reportformat ReportFmt ID: vgimportdevices_some DESC: Add devices from specific VGs to the devices file. vgimportdevices --all OO: --foreign, --reportformat ReportFmt ID: vgimportdevices_all DESC: Add devices from all accessible VGs to the devices file. vgmerge VG VG OO: --autobackup Bool, --list, --poolmetadataspare Bool ID: vgmerge_general vgmknodes OO: --ignorelockingfailure, --refresh, --reportformat ReportFmt OP: VG|LV|Tag ... ID: vgmknodes_general OO_VGREDUCE: --autobackup Bool, --force, --reportformat ReportFmt vgreduce VG PV ... OO: OO_VGREDUCE ID: vgreduce_by_pv DESC: Remove a PV from a VG. vgreduce --all VG OO: OO_VGREDUCE ID: vgreduce_all DESC: Remove all unused PVs from a VG. vgreduce --removemissing VG OO: --mirrorsonly, OO_VGREDUCE ID: vgreduce_missing DESC: Remove all missing PVs from a VG. vgremove VG|Tag|Select ... OO: --force, --noudevsync, --reportformat ReportFmt, --select String ID: vgremove_general vgrename VG VG_new OO: --autobackup Bool, --force, --reportformat ReportFmt ID: vgrename_by_name DESC: Rename a VG. vgrename String VG_new OO: --autobackup Bool, --force, --reportformat ReportFmt ID: vgrename_by_uuid DESC: Rename a VG by specifying the VG UUID. vgs OO: OO_REPORT OP: VG|Tag ... IO: --partial, --ignoreskippedcluster, --trustcache ID: vgs_general vgscan OO: --ignorelockingfailure, --mknodes, --notifydbus, --reportformat ReportFmt IO: --partial, --cache_long ID: vgscan_general OO_VGSPLIT: --autobackup Bool, --poolmetadataspare Bool OO_VGSPLIT_NEW: --alloc Alloc, --maxlogicalvolumes Uint32, --maxphysicalvolumes Uint32, --metadatatype MetadataType, --vgmetadatacopies MetadataCopiesVG vgsplit VG VG PV ... OO: OO_VGSPLIT, OO_VGSPLIT_NEW ID: vgsplit_by_pv DESC: Split a VG by specified PVs. vgsplit --name LV VG VG OO: OO_VGSPLIT, OO_VGSPLIT_NEW ID: vgsplit_by_lv DESC: Split a VG by PVs in a specified LV. config OO: OO_CONFIG OP: String ... ID: lvmconfig_general dumpconfig OO: OO_CONFIG OP: String ... ID: lvmconfig_general devtypes OO: --aligned, --binary, --nameprefixes, --noheadings, --nosuffix, --options String, --reportformat ReportFmt, --rows, --select String, --separator String, --sort String, --unbuffered, --unquoted ID: devtypes_general fullreport OO: OO_REPORT OP: VG ... IO: --partial, --ignoreskippedcluster, --trustcache ID: fullreport_general lastlog OO: --reportformat ReportFmt, --select String ID: lastlog_general lvpoll --polloperation PollOp LV ... OO: --abort, --autobackup Bool, --handlemissingpvs, --interval Number ID: lvpoll_general formats ID: formats_general help OP: String ... ID: help_general version ID: version_general pvdata ID: pvdata_general segtypes ID: segtypes_general systemid ID: systemid_general tags ID: tags_general lvmchange ID: lvmchange_general lvmdiskscan OO: --lvmpartition, --readonly ID: lvmdiskscan_general lvmsadc ID: lvmsadc_general lvmsar OO: --full, --stdin ID: lvmsar_general vgconvert VG ... OO: --force, --labelsector Number, --bootloaderareasize SizeMB, --metadatatype MetadataType, --pvmetadatacopies MetadataCopiesPV, --metadatasize SizeMB, --reportformat ReportFmt ID: vgconvert_general *dumpconfig.ccurrentdiffIncorrect version format.Failed to load profile %s.LVM configuration valid.LVM configuration invalid.profilableprofilable-commandprofilable-metadataOnly one of --type and --validate permitted.Only one of --type and --list permitted.Only one of --atversion and --sinceversion permitted.--atversion requires --type or --list--sinceversion requires --type newOnly one of --ignoreunsupported and --showunsupported permitted.--atversion has no effect with --type %s--ignoreadvanced and --ignoreunsupported has no effect with --type current--mergedconfig has no effect without --type current or --type fullFailed to merge configuration.--withcomments has no effect with --type list--withlocalpreamble has no effect with --type list--withgeneralpreamble has no effect with --type listIncorrect type of configuration specified. Expected one of: current, default, diff, full, list, missing, new, profilable, profilable-command, profilable-metadata.lvchange.c and %u other snapshot(s)Failed to prepare message.%s device number not changed.Cannot deactivate %s.%s: reactivation failed.(inherited)%s:yLogical volume %s changed.No settings changed.Polling LV %sMonitoring LV %sUnmonitoring LV %sdisk-logged core-logged clustered Failed to clear %s %s for %s.intermediateNo --rebuild found!Updating %s%slogical volume %s on disk(s).Failed to update %smetadata of %s on disk.Do you want to activate component LV in read-only mode? [y/n]: Allowing activation of component LV.Operation not permitted on hidden LV %s.Change of snapshot %s will also change its origin %s%s. Proceed? [y/n]: Logical volume %s not changed.Cannot activate LVs in a foreign VG.Internal error: Missing syncaction arg.Use syncaction check to detect and correct integrity checksum mismatches.Minor number is already not persistent for %s.Disabling persistent device number for %s.Logical volume %s will be deactivated temporarily. Continue? [y/n]: Setting persistent device number to (%d, %d) for %s.Re-activating logical volume %s.Logical volume %s is already read-only. Refreshing kernel state.Logical volume "%s" is already read only.Logical volume %s is already writable. Refreshing kernel state.Logical volume %s is already writable.Setting logical volume %s read/write.Setting logical volume %s read-only.Allocation policy of logical volume %s is already %s.Setting contiguous allocation policy for %s to %s.Updating logical volume %s on disk(s).Error when full is already %sset for %s.WARNING: Overriding readahead to %u sectors, a multiple of %uK page size.Read ahead is already auto for %s.Read ahead is already %u for %s.Setting read ahead to %u for %s.Unable to change write%s on %s while it is not in-sync.%s not found in volume group, %sCan't set all images of %s LV %s to writemostly.Minimum recovery rate cannot be higher than maximum.Changing configuration profile for LV %s: %s -> %s.Changing activation skip flag to %s for LV %s.Changing autoactivation flag to %s for LV %s.Unable to change compression for non VDO volume %s.Logical volume %s already uses --compression %c.Unable to change deduplication for non VDO volume %s.Logical volume %s already uses --deduplication %c.Internal error: Failed to check for option %sCannot change support for discards while pool volume %s is active.Logical volume %s already uses --discards %s.Logical volume %s already %szero new blocks.Cannot change existing block size %u bytes.Clear all writecache settings? WARNING: repairing a damaged cachevol is not yet possible.WARNING: cache mode writethrough is suggested for safe operation.Continue using writeback without repair?Cache %s is not clean, refusing to switch cache mode.Cannot change VDO settings for active VDO pool %s.VDO pool %s with all its LVs needs to be deactivated.Logical volume %s is not active.Refreshing logical volume %s (if active).Can't resync open logical volume %s.Do you really want to deactivate logical volume %s to resync it? [y/n]: Logical volume %s not resynced.Unable to deactivate %s for resync.Starting resync of %s%s%s%s %s.Failed to reactivate %s to resynchronize mirror.Failed to reattach %s device after clearing.Failed to reactivate %s after resync.RAID logical volume %s cannot be active remotely.Do you really want to rebuild %u PVs of logical volume %s [y/n]: Logical volume %s not rebuild.WARNING: Combining activation change with other commands is not advised.Cannot change LV properties when activating component LVs.Internal error: Missing function for command definition %d:%s.Allocation of list of failed_pvs failed.Allocation of failed_pvs list entry failed.Thin repair commnand is not configured. Repair is disabled.Failed to build thin metadata path.Failed to build pool metadata spare path.Internal error: Unable to find configuration for global/thin_repair_optionsInvalid string in config file: global/thin_repair_optionsToo many options for thin repair command.Active pools cannot be repaired. Use lvchange -an first.Cannot activate pool metadata spare volume %s.Cannot activate thin pool metadata volume %s.Cannot deactivate pool metadata spare volume %s.Repair of thin metadata volume of thin pool %s failed (status:%d). Manual repair required!WARNING: Cannot read output from %s %s.Transaction id %lu from pool "%s/%s" does not match repaired transaction id %lu from %s.Cannot deactivate thin pool metadata volume %s.Can't prepare new metadata name for %s.Can't generate new name for %s.WARNING: LV %s holds a backup of the unrepaired metadata. Use lvremove when no longer required.WARNING: New metadata LV %s might use different PVs. Move it with pvmove if required.Cache repair commnand is not configured. Repair is disabled.Failed to build cache metadata path.Internal error: Unable to find configuration for global/cache_repair_optionsInvalid string in config file: global/cache_repair_optionsToo many options for cache repair command.Only inactive cache can be repaired.Cannot activate cache pool metadata volume %s.Repair of cache metadata volume of cache %s failed (status:%d). Manual repair required!Cannot deactivate pool metadata volume %s.WARNING: If everything works, remove %s volume.WARNING: Use pvmove command to move %s on the best fitting PV.lvconvert: layer name creation failed.lvconvert: layer name generation failed.Failed to get '--replace' argumentUnable to combine split snapshots in VG with lock_type %sUnable to use %s as both snapshot and origin.Chunk size must be a power of 2 in the range 4K to 512K.Couldn't find origin volume %s in Volume group %s.Cannot use logical volume %s with active component LVs for snapshot origin.WARNING: Converting logical volume %s to snapshot exception store.THIS WILL DESTROY CONTENT OF LOGICAL VOLUME (filesystem etc.)Do you really want to convert %s? [y/n]: Couldn't deactivate logical volume %s.Aborting. Failed to wipe snapshot exception store.Logical volume %s converted to snapshot.Operation not permitted on LV %s type %s.Unable to swap pool metadata in VG with lock_type %sCan't use same LV for pool data and metadata LV %s.LV %s with type %s cannot be used as a metadata LV.Pool metadata LV %s is of an unsupported type.Cannot convert pool %s with active volumes.Failed to create internal lv names, pool name is too long.Chunk size can be only changed with --force. Conversion aborted.WARNING: Changing chunk size %s to %s for %s pool volume.Do you really want to change chunk size for %s pool volume? [y/n]: Do you want to swap metadata of %s pool with metadata volume %s? [y/n]: Aborting. Failed to deactivate %s.%s is not a mergeable logical volume.Cannot merge snapshot %s into the origin %s with merging snapshot %s.Internal error: %s is missing origin.%s is read-only external origin %s.Merging into the old snapshot origin %s is not supported.Delaying merge since snapshot is open.Delaying merge since origin volume is open.Failed to reactivate origin %s.Merging of thin snapshot %s will occur on next activation of %s.Detaching cachevol %s from LV %s.WARNING: writeback cache on %s is not complete and cannot be flushed.WARNING: cannot detach writeback cache from %s without --force.WARNING: Data may be lost by detaching writeback cache without flushing.Detach writeback cache %s from %s without flushing data?Unable to convert VDO pool in VG with lock_type %sAborting. Failed to wipe VDO data store.Converted %s to VDO pool volume and created virtual %s VDO volume.WARNING: Converting logical volume %s to VDO pool volume %s formating.WARNING: Using invalid VDO pool data MAY DESTROY YOUR DATA!Writecache requires consistent logical block size for LV devices.Writecache block size %u not allowed with device logical block size 4096.Using writecache block size %u for thin pool data, logical block size %u, physical block size %u.Test mode skips checking fs block size.Using writecache block size %u for unknown file system block size, logical block size %u, physical block size %u.WARNING: unable to detect a file system block size on %sWARNING: using a writecache block size larger than the file system block size may corrupt the file system.Use writecache block size %u? [y/n]: Writecache block size %u cannot be larger than file system block size %u.Internal error: Wrong params for lvconvert _create_id.Internal error: Name "%s/%s" is too long.Poll operation ID allocation failed.Failed to copy one or more poll operation ID members.Convert poll ID list allocation failed.Converting thin%s segment type for %s to %s is not supported.For pool data volume conversion use %s.For pool metadata volume conversion use %s.Internal error: Volume %s is not a COW.Unable to split off snapshot %s with virtual origin.Unable to split snapshots in VG with lock_type %s.Do you really want to split off active logical volume %s? [y/n]: Splitting snapshot %s from its origin.Logical Volume %s split from its origin.Conversion of tracking raid1 LV %s is not supported.Failed to find RaidLV of RAID subvolume %s.Conversion of tracked raid1 subvolume %s is not supported.Internal error: LV %s is already a pool.Use a different LV for pool metadata %s.Mirror logical volumes cannot be used for pool metadata.Try "%s" segment type instead.Pool metadata LV %s is too small (%u extents) for required metadata (%u extents).WARNING: Using mismatched cache pool metadata MAY DESTROY YOUR DATA!Aborting. Failed to activate metadata lv.Aborting. Failed to wipe metadata lv.Aborting. Failed to deactivate metadata lv. Manual intervention required.Aborting. Failed to deactivate logical volume %s.Failed to activate pool logical volume %s.Failed to deactivate pool data logical volume %s.Failed to deactivate pool metadata logical volume %s.Failed to unlock pool data LV %s/%sFailed to unlock pool metadata LV %s/%sWARNING: Converting %s to %s pool's data%s %s metadata wiping.Pool metadata extents %u chunk_size %uInternal error: Invalid lvconvert pool commandInternal error: Invalid lvconvert pool command.LV %s with type %s cannot be used as a %s pool LV.Cannot convert logical volume %s under snapshot.The --poolmetadata option is required to swap metadata.LV %s with type %s cannot be converted to a cache pool.LV %s is already used as a cachevol.Use a different LV for cache pool LV and cache LV %s.LV %s could not be converted to a cache pool.Internal error: LV %s is not a cache pool data volume.Cache pool %s is already in use.Do you want wipe existing metadata of cache pool %s? [y/n]: To preserve cache metadata add option "--zero n".WARNING: Reusing mismatched cache pool metadata MAY DESTROY YOUR DATA!WARNING: Reusing cache pool metadata %s for volume caching.Redirecting operation to data sub LV %s.Can't use same LV %s for thin pool and thin volume.Can't use lock_type %s LV as external origin.Aborting. Unable to deactivate new LV. Manual intervention required.Converted %s to thin volume with external origin %s.Unable to deactivate failed new LV. Manual intervention required.LV %s with type %s cannot be converted to a thin pool.Use a different LV for thin pool LV and thin LV %s.LV %s could not be converted to a thin pool.Internal error: LV %s cannot be found.Internal error: LV %s is not a thin pool.Cannot convert cache volume %s with %s cache mode to external origin.To proceed, run 'lvchange --cachemode writethrough %s'.Cache %s is not clean, refusing to convert to external origin.Cannot add integrity while LV is missing PVs.Logical volume %s has added integrity.Logical volume %s has removed integrity.With tag as cachedevice, --cachesize is required.PV %s is in use, --cachesize is required.Use all %s from %s for cache? [y/n]: Use --cachesize SizeMB to use a part of the cachedevice.Cannot allocate from more than %u cache devices.No cachedevice specified to create a cachevol.cachedevice not found in VG %s.Failed to create cachevol LV name.Failed to generate cachevol LV format.Failed to generate cachevol LV name.Creating cachevol LV %s with size %s.Erase all existing data on %s? [y/n]: Can't prepare new cachevol name for %s.Failed to unlock fast LV %s/%sCannot find LV with cache from %s.WARNING: writecache on %s is not complete and cannot be flushed.WARNING: cannot detach writecache from %s without --force.WARNING: Data may be lost by detaching writecache without flushing.Detach writecache %s from %s without flushing data?Detaching writecache skipping cleaner...Detaching writecache without cleaner...Failed to activate LV to clean writecache.Detaching writecache already clean.Detaching writecache setting cleaner.Failed to set cleaner cachesetting to flush cache.See lvchange --cachesettings cleaner=1Detaching writecache finished cleaning.Failed to monitor writecache cleaner progress.Logical volume %s writecache has been detached.Logical volume %s is not cached and %s is removed.Logical volume %s is not cached and %s is unused.Internal error: Unknown cache split command.WARNING: Cache origin logical volume %s is missing.WARNING: Cache pool data logical volume %s is missing.WARNING: Cache pool metadata logical volume %s is missing.Cannot uncache writeback cache volume %s without --force.WARNING: Uncaching of partially missing %s cache volume %s might destroy your data.Do you really want to uncache %s with missing LVs? [y/n]: Logical volume %s is not cached.Detaching cachepool %s from LV %s.Cannot split cache pool while PVs are missing, see --uncache to delete cache pool.Cannot convert %s LV %s to %s.Cannot specify mirrors with linear type.Unable to %s images by specified amount.Exactly one image must be split off from %s when tracking changes.--corelog and --mirrorlog are only compatible with mirror devicesOnly up to %u mirrors in %s LV %s supported currently.Cannot add raid images with integrity for this raid level.Logical volume %s successfully converted.RAID module does not support RAID0.RAID module does not support RAID10.This conversion is not supported for raid with integrity.LV %s must be linear to use as a writecache.LV %s must be inactive to attach.Failed to sync local dev names.Unknown memory usage for unknown writecache block_size_sectors %uWARNING: writecache size %s will use %llu GiB of system memory (%llu GiB).Continue adding writecache? [y/n]: Cannot initialize readonly LV %sFailed to activate LV %s for zeroing.Failed to deactivate LV %s for zeroing.Logical volume %s now has writecache.Cannot merge snapshot %s into the read-only external origin %s.Cannot merge snapshot %s into the read-only origin %s. (Use lvchange -p rw).Unable to merge invalidated snapshot LV %s.Can't initialize snapshot merge. Missing support in kernel?Delaying merge since origin is open.Conversion starts after activation.Merging of snapshot %s will occur on next activation of %s.WARNING: Logical volume %s is already not mirrored.Cannot convert logical volume %s with active component LV(s).Can't add mirror to out-of-sync mirrored LV: use lvchange --resync first.Can't add additional mirror images to mirror %s which is under snapshots.%s is already being converted. Unable to start another conversion.Failed to insert resync layer.ABORTING: Failed to remove temporary mirror layer %s.Manual cleanup with vgcfgrestore and dmsetup may be required.--trackchanges is not available to 'mirror' segment type.--corelog and --mirrorlog are only compatible with mirror devices.Mirror segment type cannot be used for thinpool%s. Try "%s" segment type instead.Mirrors are not yet supported on cache LVs %s.Unable to split mirrors in VG with lock_type %sOnly up to %d images in mirror supported currently.Unable to reduce images by specified amount - only %d in %sAdjusting mirror image count of %sCopying region size %s from existing mirror.Mirror log region size cannot be changed on an existing mirror.Logical volume %s has multiple mirror segments.Cannot both allocate and free extents when specifying physical volumes to use.Please specify the operation in two steps.Logical volume %s being converted.Conversions to --type mirror require -m/--mirrorsUnknown operation on mirror LV %s.Unknown operation on raid LV %s.Unknown operation on striped or linear LV %s.Conversion using --type %s is not supported.--mirrorlog and --corelog are incompatible.--mirrors/--type mirror/--type raid* and --splitmirrors are mutually exclusive.Please name the new logical volume using '--name'Internal error: Changing conv_type from %d to %d.--stripes or --stripesize argument is only valid with --mirrors/--type mirror/--type raid*/--type striped/--type linear, --repair and --thinpool--chunksize is only available with snapshots or pools.--zero is only available with snapshots or pools.cannot be used with --type raid0 or --type striped or --type linearFailed to allocate poll identifier for lvconvert.Attempt to replace failed RAID images (requires full device resync)? [y/n]: Failed to replace faulty devices in %s.Faulty devices in %s successfully replaced.Use 'lvconvert --repair %s' to replace failed device.Mirror status: %d of %d images failed.Mirror log status: %d of %d images failed.Attempt to replace failed mirror log? [y/n]: Attempt to replace failed mirror images (requires full device resync)? [y/n]: WARNING: Trying to up-convert to %d images, %d logs.WARNING: Failed to replace %d of %d images in volume %s.WARNING: Failed to replace %d of %d logs in volume %s.WARNING: %d missing and now unallocated Physical Volumes removed from VG.Unsupported volume type for repair of volume %s.Volume %s is consistent. Nothing to repair.Failed to initialize processing handle.Internal error: Unknown pool conversion.Detaching writecache interrupted - locking VG failed.detach writecache check clean reading vg %sDetaching writecache interrupted - reading VG failed.Detaching writecache interrupted - reading VG error %x.Detaching writecache interrupted - LV not found.Detaching writecache interrupted - LV not active.Detaching writecache cleaning %llu blocksThis command can be cancelled and rerun to complete writecache detach.Detaching writecache completed cleaning.Detaching writecache cachevol failed.Removing the writecache cachevol failed.Logical volume %s write cache has been detached.lvconvert.c-i-otransaction="%s_meta%%dManual repair required._mimagetmp_%dlayer name creation failed.Failed to insert resync layerConversion aborted.WARNING: %s not zeroed.Metadata LV %s not found.Can't convert locked LV %s.pvmove_tmetaVolume %s replaced origin %s.Cannot activate %s.withWITHOUTMergedConvertedLogical volume %s not split.Unknown pool metadata LV %s.Creation of pool LV failed.Failed to lock pool LV %s.Converted %s to %s pool. and metadata volumes and Cache pool %s not found.Thin pool %s not found.LV does not have integrity.Device %s not found.PV %s not found in VG.%s_cache%s_cache%%dFailed to create cachevol LVLV %s is already in use.%s_cvolCannot find cache %s.Invalid writecache settings.Invalid cachevol LV.MemTotal:%*s%llu%*sLV %s could not be zeroed._wcorigMerging of volume %s started.Setting logging type to %s.Logical volume %s converted.Cannot convert LV %s.No usable images left in %s.LVM_VG_NAMEvg/lv string alloc failed.Failed to remove temporary sync layer.Failed to swap %s with merging %s.Logical volume %s is no longer merging origin, polling has finished.Merge of snapshot into logical volume %s has finished.Could not remove snapshot %s merged into %s.%s: Failed query for merging percentage. Aborting merge.%s: Merging snapshot invalidated. Aborting merge.%s: Merge failed. Retry merge or inspect manually.lvconvert_poll.cpmove_tmeta%s: %s: %s%%LV %s is not merged.skipped from activation inactive auto activated read-only origin %s%s%s%s%s%s%slvcreate.cis unsupported with cacheis supported only with cacheis unsupported with snapshotsis unsupported with mirrorsis unsupported with raidsis supported only with raidsis unsupported with thinsis supported only with thinsis unsupported with VDOsmay not be negativemay not be zeroSetting logging type to %sUsing 2 stripes for %s.Using 3 stripes for %s.Setting chunksize to %s.Failed to get tag.is only available with pools, %ORIGINwith generated name as snapshot of Failed to remove new LV %s.Internal error: Buffer is too small for dm_snprintf().Cannot zero %slogical volume with option -Zy or -Wy.Ignoring option -Zy or -Wy for unzeroable %s volume.Inconsistent volume group names given: "%s" and "%s"Unable to create LV with unknown segment type %s.is unsupported with cache poolsCannot create read-only cache pool.Snapshot segment type is incompatible with thin pools.is unsupported with snapshots and --thinpoolSnapshot segment type requires size or extents.is supported only with sparse snapshotsis supported only with mirrorsPlease specify either size or pooldatasize.is supported only with thin pool creationThin segment type requires --virtualsize.Switching from thin to thin pool segment type.is unsupported with thin poolsCannot create read-only thin pool.is supported only with VDO pool creationis supported only with mirrors or raids--mirrors is supported only with mirrors or raidsis supported only with pools and snapshotsis supported only with vdo, sparse snapshots and thinsSegment type %s does not support --errorwhenfull.Please specify a logical volume to act as the cache pool or origin.Unsupported syntax, cannot use cache origin %s and --cachepool %s.The cache pool or cache origin name should include the volume group.Creation of cached volume and cache pool in one command is not yet supported.Please specify a logical volume to act as the snapshot origin.The origin name should include the volume group.Ambiguous %s name specified, %s and %s.The %s name should include the volume group.Please provide a volume group nameVolume group name expected (no slash)Logical volume name %s and pool name must be different.Volume group name %s has invalid charactersPlease specify either size or extents (not both).Please specify either size or extents.Dropping VDO pool header size to 0 to support maximal size %s.RAID10 currently supports only 2-way mirroring (i.e. '-m 1')--mirrors must be at least 1 with segment type %s.Redundant mirrors argument: default is 0Only up to %u stripes in %s supported currently.Only up to %u mirrors in %s supported currently.nosync option prohibited on RAID6.regionsize in configuration file is invalid.Please use only one of --corelog or --mirrorlog.Minimum of 2 stripes required for %s.Stripes argument cannot be used with segment type, %sMinimum of 3 stripes required for %s.Stripe size argument cannot be used with segment type, %sMirror argument cannot be used with segment type, %sAdjusting %s %s region size to required minimum of stripe size %s.Cannot use stripes with linear type.Conflicting contiguous and alloc arguments.Unable to allocate memory for tag %s.Segment type %s cannot use pool %s.Logical volume %s already exists in Volume group %s.Persistent major and minor numbers are unsupported with pools.Ambigous --readahead parameter specified. Please use either with pool or volume.Please specify name of existing pool.Pool %s not found in Volume group %s.Snapshot origin LV %s not found in Volume group %s.Thin pool volume %s not found in Volume group %s.Logical volume %s is not a thin pool volume.Please specify either size or extents with snapshots.Logical volume %s is not a thin volume. Thin snapshot supports only thin origins.Switching from snapshot to thin segment type.Change of volume permission is unsupported with cache conversion, use lvchange.is unsupported with cache conversionSkipping activation of cache origin %s.Cannot activate cache origin %s.Cannot deactivate activate cache origin %s.Ambiguous syntax, please create --type cache-pool %s separately.Unable to create RAID LV: requires minimum VG extent size %sUnable to create RAID(1)0 LV: insufficient number of devices.Segment type 'raid0' requires 2 or more stripes.Number of stripes must be at least %d for %sPlease either create snapshot or thin volume.Please specify device size(s).is only available when creating thin poolOnly specify Physical volumes when allocating thin pool.Please either create VDO or snapshot.Maximal supported VDO virtual size is %s.Please express size as %%FREE%s, %%PVS or %%VG.Internal error: Couldn't find origin volume.Can't use %s size. Maximal supported VDO POOL volume size with slab size %s is %s.Using maximal supported VDO POOL volume size %s (with slab size %s).Calculated size of logical volume is 0 extents. Needs to be larger.Converted %u%% of %s (%u) extents into %u (with mimages %u and stripes %u for segtype %s).Internal error: Missing snapshot chunk size.Reducing COW size %s down to maximum usable size %s.Rounding size (%d extents) down to stripe boundary size (%d extents)Not enough space for thin pool creation.Adjusted size of logical volume is 0 extents. Needs to be larger.Internal error: --thinpool not identified.Internal error: Inconsistent snapshot and origin parameters identified.Internal error: Failed to identify what type of thin target to use.Making pool %s in VG %s using segtype %sNo space for sanlock lock, extend the internal lvmlock LV.Making thin LV %s in pool %s in VG %s%s%s using segtype %s.Use lvconvert to create thin pools and cache pools in a shared VG.Removal of created spare volume failed. Manual intervention required.Failed to find LV %s to add writecache.Removing new LV after failing to add writecache.Failed to deactivate new LV %s.Failed to find LV %s to add cache.Removing new LV after failing to add cache.=16EiB).Can't parse size argument.stub.hOption %s %s.yesyyalnylSize may not be negative.Size may not be positive.Number may not be negative.Extents may not be negative.Extents may not be positive.wrRegion size may not be zero.pvsegpv_headerlabel_headerheadersmetadata_allmetadata_searchmetadata_areabackup_to_rawsystem ID: %sLVM version: %sLibrary version: %sDriver version: %sConfiguration: %sAvailable lvm commands:%-16.16s%sTZ:/etc/localtimeCouldn't copy command line.Version: %sParsing: %sCorrect command syntax is:Command requires options: %sIgnore opt %dInvalid devices file name.Invalid units specificationProcessing command: %sCommand pid: %dSystem ID: %sO_DIRECT will be usedskiplvskipvgskipglCompleted: %sLVM_LVMLOCKD_SOCKETToo many arguments: %squitexitlvm.staticinitrd-lvmstdin stream openstdin stream open: %s stdout stream openstderr stream open: %s LVM_OUT_FDLVM_ERR_FDLVM_REPORT_FDLVM_SUPPRESS_FD_WARNINGSRLIMIT_NOFILEgetrlimit/usr/sbin/lvmLVM_DID_EXECunsetenv-h-?Command definition index %d enum %d id %sInternal error: Command %s not found.Use --longhelp to show all options and advanced commands.Unable to allocate memory for command line arguments.Option%s%c%s%s may not be repeated.File descriptor %d (%s) leaked on %s invocation.Close failed on stray file descriptor %d (%s): %sWARNING: Running as a non-root user. Functionality may be unavailable.Percentage is too big (>=%d%%).Multiple sign symbols detected.Size requires number argument.Can't parse size argument at '%c'.%s%sSize is not a multiple of 512. Try using %lu or %lu.There's no 'lvmsadc' command in LVM2.Please use the superior 'dmstats' facilities instead.There's no 'lvmsar' command in LVM2.There's no 'pvdata' command in LVM2.Use lvs, pvs, vgs instead; or use vgcfgbackup and read the text file backup.There's no 'lvmchange' command in LVM2.Use 'dmsetup' commands to reset the kernel device-mapper driver.The vgconvert command has been removed along with the lvm1 format.Use a previous version of lvm to convert the lvm1 format to lvm2.%s and %s are synonyms. Please only supply one.Command profile '%s' requested via environment variable.Only one of --profile or --metadataprofile allowed.Only one of --profile or --commandprofile allowed.Size may not be relative/signed.Selected cache metadata format %d is not supported.Extents may not be relative/signed.Region size may not be negative.Region size is too big (max %u).Region size must be a multiple of machine memory page size (%d bytes).Region size must be a power of 2.Internal error: Failed to parse command definitions.Internal error: Failed to find command id %s../configure --build=x86_64-redhat-linux-gnu --host=x86_64-redhat-linux-gnu --program-prefix= --disable-dependency-tracking --prefix=/usr --exec-prefix=/usr --bindir=/usr/bin --sbindir=/usr/sbin --sysconfdir=/etc --datadir=/usr/share --includedir=/usr/include --libdir=/usr/lib64 --libexecdir=/usr/libexec --localstatedir=/var --sharedstatedir=/var/lib --mandir=/usr/share/man --infodir=/usr/share/info --with-default-dm-run-dir=/run --with-default-run-dir=/run/lvm --with-default-pid-dir=/run --with-default-locking-dir=/run/lock/lvm --with-usrlibdir=/usr/lib64 --enable-fsadm --enable-write_install --with-user= --with-group= --with-device-uid=0 --with-device-gid=6 --with-device-mode=0660 --enable-pkgconfig --enable-cmdlib --enable-dmeventd --enable-blkid_wiping --with-cluster=internal --enable-cmirrord --with-udevdir=/usr/lib/udev/rules.d --enable-udev_sync --with-thin=internal --with-cache=internal --enable-lvmpolld --enable-lvmlockd-dlm --enable-lvmlockd-dlmcontrol --enable-lvmlockd-sanlock --enable-dbus-service --enable-notify-dbus --enable-dmfilemapd --with-writecache=internal --with-vdo=internal --with-vdo-format=/usr/bin/vdoformat --with-integrity=internal --disable-silent-rulesUse 'lvm help ' for more informationFailed to strdup command basename.Error during parsing of command line.No command with matching syntax recognised. Run '%s --help' for more information.Nearest similar command has syntax:Command does not accept option: %s%s%s.Command does not accept argument: %s.Command does not accept option combination: %s with %sCommand does not accept options: %sRecognised command %s (id %d / enum %d).Updated config file invalid. Aborting.PARTIAL MODE. Incomplete logical volumes will be processed.--partial and --activationmode are mutually exclusive argumentsInvalid activation mode given.Ignoring unknown search_for_devnames setting, using %s.Failed to copy devices file name.A --devices list cannot be used with --devicesfile.DEGRADED MODE. Incomplete RAID LVs will be processed.%s: Command not permitted while global/metadata_read_only is set.WARNING: see lvmlockd(8) for information on using cluster/clvm VGs.WARNING: locking_type (%d) is deprecated, using --nolocking.WARNING: locking_type (%d) is deprecated, using --sysinit --readonly.WARNING: locking_type (%d) is deprecated, using file locking.WARNING: File locking is disabled.Ignoring unknown md_component_checks setting, using auto.Using md_component_checks %s use_full_md_check %dIgnore lvmlockd for pvscan cache.WARNING: skipping LV lock in lvmlockd.WARNING: skipping VG lock in lvmlockd.WARNING: skipping global lock in lvmlockd.Run `%s --help' for more information.Failed to read --devices args.Line too long (max 255) beginning: %sInternal error: Failed command did not use log_errorCommand failed with status code %d.Specify options after a command: lvm [command] [options].No such command. Try 'lvm help'.| ܡ̡ l$/proc/self/fdFailed to apply %s %s.Setting global %s "%s".Failed to add %s %s.command profileGiving preference to command profile specified on command line over the one specified via environment variable.metadata profileLVM_COMMAND_PROFILEC`?`CAACDevices file not enabled.lvmdevices.cDevices file does not exist.No device found for %s.Invalid PVID.Found PVID %s on %s.Device not removed.No devices file entry for %s. PART=%dFailed to create the devices file.Checking filters with data for %sfilter result: %s in devices file is excluded by filter: %s.Not searching for missing devnames, search_for_devnames="none".Updated devices file to version %sNo update for devices file is needed.Updates needed for devices file.WARNING: adding device %s that is excluded: %s.PVID already exists in devices file for %s.Filtering devices (no data) for pvid searchFiltering devices (with data) for pvid searchPVID %s not found on any devices.WARNING: PVID %s found on %s which is excluded: %sDevice %s is used by an active LV, continue to remove? PVID not found in devices file.Multiple devices file entries for PVID %s (%s %s), remove by device name.Device %s IDTYPE=%s IDNAME=%s DEVNAME=%s PVID=%s%s%-*s [%15s] %slvmdiskscan.cdev_iter_create failedCouldn't get size of "%s"LVM physical volume%d disk%s%d partition%s%d LVM physical volume%sWARNING: only considering LVM devices%d LVM physical volume whole disk%s--polloperation parameter is mandatoryArgument to --interval cannot be negativelvpoll.cProvide LV nameMovedUnknown polling operation %sPlease enter one or more logical volume paths or use --select for selection.lvremove.clvrename.cExisting logical volume "%s" not found in volume group "%s"Cannot rename a RAID %s directlyCannot rename %s while it is tracking a split imageExisting historical logical volume "%s" not found in volume group "%s"Renamed "%s%s" to "%s%s" in volume group "%s"Please use a single volume group name ("%s" or "%s")Old and new logical volume names requiredPlease provide a valid volume group nameLogical volume names must have the same volume group ("%s" or "%s")Old name references live LV while new name is for historical LV.New logical volume name "%s" may not exceed %zu characters.New logical volume name may not be blankNew logical volume name "%s" is invalidOld and new logical volume names must differLogical volume %s not found in volume group %s.Ignoring size parameters with --use-policies.Can't reduce pool metadata size.Please specify either size or extents but not both.Negative argument not permitted - use lvreduce.Positive sign not permitted - use lvextend.Please provide the logical volume name.Please specify a logical volume path.Mirrors argument may not be signed.Stripes argument may not be negative.Stripesize may not be negative.lvresize.cACTIVE OriginalSnapshot%s%s '%s%s/%s' [%s] %slvscan.cIgnoring lvscan --cache because lvmetad is no longer used.Failed to generate list of copied LVs: can't abort.ABORTING: Failed to generate list of copied LVsABORTING: Segment progression failed.Can't reread VG for %s error flags %x%s: No pvmove in progress - already finished or aborted.Can't find LV in %s for %s. Already finished or removed.%s: Interrupted: No longer active.Poll ID list allocation failed.Internal error: Wrong params for _copy_poll_operation_id.Failed to copy one or more poll_operation_id members.Internal error: Handle is undefined.Device name for LV %s not found in metadata. (unfinished pvmove mirror removal?)%s: Skipping inactive LV. Try lvchange or vgchange.Failed to create poll_id_list.ABORTING: Mirror percentage check failed.ABORTING: Polling interrupted for %s.ABORTING: Can't lock VG for %s.Can't find VG %s. No longer active.ABORTING: Can't reread VG for %s error flags %x.Argument to --interval cannot be negative.Checking progress %s waiting every %u seconds.devicefile name too long for lvmpolldpolldaemon.cMissing LV uuid within: %s/%sCan't find LV in %s for %s.afterResolve duplicate PV UUIDs with vgimportclone (or filters).Volume group containing %s does not support tagsVolume group containing %s has active logical volumesCan't change tag on Physical Volume %s not in volume groupCan't change PV '%s' without -ff.Allocatability not supported by orphan %s format PV %sPhysical volume "%s" is already allocatable.Physical volume "%s" is already unallocatable.Override preferred number of copies of VG %s metadata? [y/n]: Failed to generate new random UUID for %s.pv_write with new uuid failed for %s.Physical volume %s not changedFailed to set pvid for devices file.Failed to update devices file.Setting physical volume "%s" NOT allocatableSetting physical volume "%s" allocatablePlease give one or more of -x, -uuid, --addtag, --deltag or --metadataignorePlease give a physical volume path or use --select for selection.Option --all and PhysicalVolumePath are exclusive.%d physical volume%s changed / %d physical volume%s not changedpvchange.cChanging uuid of %s to %s. wrappedpvck.cprecommitwxFailed to create file %sid = seqno = description = creation_time = -- Skip writing in test mode.Failed to write new mda textmda_header.magicCHECK: no mem for printing %smda_header_%d.checksum 0x%xmda_header_%d.magic 0x%smda_header_%d.version %umda_header_%d.start %llumda_header_%d.size %llulabel_header at %llulabel_header.idlabel_header.id %slabel_header.sector %llulabel_header.crc 0x%xlabel_header.offset %ulabel_header.typelabel_header.type %sLABELONELVM2 001pv_header at %llupv_header.pv_uuidpv_header.pv_uuid %spv_header.device_size %llupv_header_extension at %llupv_header_extension.flags %uzero metadata copiesCHECK: second mda not foundNo lvm label found on device.No mda1 offset found.No mda2 offset found.Invalid metadata file.Write new LVM header to %s? Failed to write new headerFailed to set up device %s.Cannot use %s: %s.Cannot access %s. %63[^=]=%63s %nInvalid setting at: %smetadata_offsetbackup_filemda_offsetmda2_offsetmda2_sizedevice_sizemda_numInvalid setting: %sCannot open file: %sCannot access file: %sEmpty file: %sCannot read file: %s# GeneratedNo mda location.Unknown dump value.Write LVM header to device? Unknown repair value.mda_header_%d.raw_locn[%d] at %llu # %s%smda_header_%d.raw_locn[%d].offset %llumda_header_%d.raw_locn[%d].size %llumda_header_%d.raw_locn[%d].checksum 0x%xmda_header_%d.raw_locn[%d].flags 0x%x # RAW_LOCN_IGNOREDmda_header_%d.raw_locn[%d].flags 0x%xCHECK: mda_header_%d.raw_locn[%d] for precommit not emptyCHECK: mda_header_%d.raw_locn[%d].size larger than metadata area sizeskip invalid metadata with len %llu at %llumetadata at %llu length %llu crc %08x vg %s seqno %u id %sWARNING: parse error for metadata at %lluWARNING: unexpected terminating bytes for metadata at %lluWARNING: metadata from multiple VGs was found.Failed to extract full metadata text at %llu, skipping.CHECK: failed to read mda_header_%d at %lluWriting metadata at %llu length %llu crc 0x%08x mda%dWriting mda_header at %llu mda%dWrite new LVM metadata to %s? Failed to write new mda headerMetadata text %llu too large for mda_size %llu max %lluCHECK: failed to read mda_header at %llumda_header_%d at %llu # metadata areaCHECK: mda_header_%d.checksum expected 0x%xCHECK: mda_header_%d.magic expected 0x%sCHECK: mda_header_%d.version expected %uCHECK: mda_header_%d.start does not match pv_header.disk_locn.offset %lluCHECK: mda_header_%d.size does not match pv_header.disk_locn.size %lluCHECK: failed to read metadata area at offset %llu size %lluFailed to write file %s metadata area size %llu.CHECK: mda_header_%d.raw_locn[%d] no mem for metadata text size %lluCHECK: failed to read metadata text at mda_header_%d.raw_locn[%d].offset %llu size %llu part_a %llu %lluCHECK: failed to read metadata text at mda_header_%d.raw_locn[%d].offset %llu size %llu part_b %llu %lluCHECK: failed to read metadata text at mda_header_%d.raw_locn[%d].offset %llu size %lluCHECK: metadata text at %llu crc does not match mda_header_%d.raw_locn[%d].checksumCHECK: failed to set up metadata parsingCHECK: failed to parse metadata text at %llu size %llumetadata text at %llu crc 0x%x # vgname %s seqno %uCHECK: failed to read label_header at %lluCHECK: label_header.id expected %sCHECK: label_header.sector expected %dCHECK: label_header.crc expected 0x%xCHECK: label_header.offset expected 32CHECK: label_header.type expected %sCHECK: pv_header.pv_uuid invalid formatpv_header.disk_locn[%d] at %llu # location of data areapv_header.disk_locn[%d].offset %llupv_header.disk_locn[%d].size %llupv_header.disk_locn[%d] at %llu # location list endCHECK: problem with pv_header.disk_locn[%d] offset calculationpv_header.disk_locn[%d] at %llu # location of metadata areaWARNING: pv_header.disk_locn[%d].offset %llu is unexpected # for first mdapv_header_extension.version %upv_header_extension.disk_locn[%d] at %llu # bootloader areapv_header_extension.disk_locn[%d].offset %llupv_header_extension.disk_locn[%d].size %llupv_header_extension.disk_locn[%d] at %llu # location list endCHECK: problem with pv_header_extension offset calculationFound bad header or metadata values.Metadata input file is required.See --repairtype pv_header to repair headers.No metadata areas on device to repair.No metadata areas found on device.WARNING: Cannot get device size.WARNING: No LVM label found on %s. It may not be an LVM device.Skipping mda2 (wrong mda_header.version)Skipping mda2 (no matching VG UUID in metadata area)Skipping mda2 (wrong mda_header.start)Found mda2 header at offset %llu size %lluWARNING: PV will have no metadata with zero metadata areas.WARNING: no previous metadata areas found on device.Should a metadata area be included? To repair with zero metadata areas, use --settings "mda_offset=0 mda_size=0".mda2_offset setting %llu does not match mda2_offset found on disk %llu.mda2_size setting %llu does not match mda2_size found on disk %llu.Failed to read label_header at %lluWARNING: device_size setting %llu bytes does not match device size %llu bytes.Metadata input file is needed for pv_header info.See pvck --dump to locate and create a metadata file.WARNING: existing PV UUID %s does not match pv_uuid setting %s.PV UUID %s not found in metadata file.PV UUID %s in existing pv_header not found in metadata file.PV name %s not found in metadata file.No valid PV UUID, specify a PV UUID from metadata in --settings.Failed to scan devices to check PV UUID.Cannot use PV UUID %s which exists on %sWriting label_header.crc 0x%08x pv_header uuid %s device_size %lluWriting data_offset %llu mda1_offset %llu mda1_size %llu mda2_offset %llu mda2_size %lluFailed to parse UUID from pv_uuid setting.Invalid raw text metadata in file. File size is too small.Invalid raw text metadata in file.(pvck stdout is not valid input, see pvck -f.)(metadata backup file is not valid input.)WARNING: unexpected final bytes of raw metadata, expected \n\n\0.Invalid raw text metadata in file. (No VG UUID found.)WARNING: file data does not begin with a VG name and may be invalid.Write input file data to disk?Failed to read the first 4096 bytes of device %s.Specify at least two values from: mda_num, mda_offset, mda_size.Ignoring mda2 values from settings.Specify at least two values from: mda_num, mda2_offset, mda2_size.Invalid mda_num=1 and mda2 settings.Using common defaults for first mda: offset %llu size %llu.Override defaults with --settings "mda_offset= mda_size="Using defaults for second mda: offset %llu size %llu.Ignoring mda1_offset %llu mda1_size %llu from pv_header.Ignoring mda2_offset %llu mda2_size %llu from pv_header.Searching for metadata at offset %llu size %lluCHECK: mdas have different raw_locn[0].checksum valuesSet backup file in --settings backup_file=pathFile does not appear to contain a metadata backup.Writing label_header.crc 0x%08xFound label on %s, sector %llu, type=LVM2 001Found text metadata area: offset=%llu, size=%lluCould not find LVM label on %s--uuid is required with --restorefile--restorefile is required with --uuidCan only set uuid on one volume at oncePhysical volume size may not be negativeUnable to read volume group from %sCan't find uuid %s in backup file %spvcreate.cDevice "%s" has a capacity of %sPhysical volume "%s" of volume group "%s" is exported"%s" is a new physical volume of "%s"Option -c not allowed with option -mOption -c is not allowed with option -spvdisplay.cFailed to clone VG or LV name.--name takes a logical volume name.Named LV and old PV must be in the same VG.Incomplete LV name supplied with --name.Logical volume name %s is invalid.pvmove not allowed on raid LV with integrity.pvmove in a shared VG requires a named LV.pvmove not allowed on internal sanlock LV.pvmove in a shared VG requires exclusive lock on named LV.Detected pvmove in progress for %s.WARNING: Ignoring remaining command line arguments.ABORTING: Failed to generate list of moving LVs.ABORTING: Temporary mirror activation failed.No extents available for allocation.Creation of temporary pvmove LV failed.lvs_changed list struct allocation failed.Unable to pvmove when %s volume %s is present.Unable to pvmove device used for writecache.Unable to move device used for writecache cachevol %s.Unable to pvmove device used for raid with integrity.Internal error: LV name %s is too long.Can't find rimage or rmeta suffix.Can't find '_' after suffix %s.Raid sublv for name %s too long.Removing PV %s from trim list.Skipping LV %s which is not locally exclusive%s.Skipping LV %s which cannot be activated.Moving %u extents of logical volume %s.All data on source PV skipped. It contains locked, hidden or non-top level LVs only.Failed to convert pvmove LV to mirrored.Failed to split segments being moved.ABORTING: Temporary pvmove mirror activation failed. Run pvmove --abort.Internal error: Wrong params for _pvmove_create_id.Failed to allocate poll identifier for pvmove.Required device-mapper target(s) not detected in your kernel.Enable lvmpolld when using lvmlockd.Specify pvmove args when using lvmlockd.pvmove.cFailed to find an LV name.Logical volume %s not found.pvmove%dCan't find sub LV %s.Can't find PVs for sub LV %s.Skipping locked LV %s.No data to move for %s.Failed to allocate lvid.Failed to clone LV name.Internal error: %s is not a proper mirror imageInternal error: %s is not a pvmove mirror of LV-typeInternal error: Mirror image %u not found in segmentABORTING: Removal of temporary mirror failedABORTING: Unable to deactivate temporary logical volume %s.ABORTING: Removal of temporary pvmove LV failedWriting out final volume group after pvmoveABORTING: Failed to write new data locations to disk.pvmove_poll.cRemoving temporary pvmove LVPlease enter a physical volume pathWARNING: skipping global lock for force.pvremove.cInternal error: Invalid resize params.Please supply physical volume(s)%d physical volume(s) resized or updated / %d physical volume(s) not resizedpvresize.cpvscan.c%-*s with UUID %sInvalid PV name with uuid.PV %-*s %-*s %s [%s]/run/lvm/pvs_onlineCheck pv online: %sCheck pv online %s: yesCheck pv online %s: no/run/lvm/vgs_onlineCreate vg online: %sFailed to create %s: %dFailed to open %sNo info in %sNo device numbers in %svg:No vgname in %spvscan autoactivating VG %s.%s: autoactivation failed./run/lvm/pvs_lookupDid not create %s: %dwrite_lookup_file %s%d:%d vg:%s Create pv online: %s %d:%d %sWARNING: Failed to open %s.ignore lookup file line %sonline_devs %s %signore %s with no lvm info.pvscan[%d] PV %s not used.PV %s has no VG metadata.PV %s not found in VG %s.PV %s missing device size.ignore md component %s.PV %s ignore shared VG.PV %s ignore foreign VG.PV %s ignore exported VG.pvscan[%d] PV %s online.VG %s complete after recheck.PV %s online, VG unknown.VG unknownVG %s finishedLVM_VG_NAME_COMPLETE='%s' VG %s completeLVM_VG_NAME_INCOMPLETE='%s' VG %s incompleteFailed to find LVs using %s.LV %s completeFailed to check partial lvs.LV %s incompleteof exported volume group(s)in no volume groupUnlink vg online: %sRemove pv online devno %d:%dUnlink pv online %sUnlink pvs_lookup: %sLVM_EVENT_ACTIVATION=0/run/lvmCreating run_dir.Creating pvs_online_dir.Creating vgs_online_dir.Creating pvs_lookup_dir.pvscan[%d] %s excluded: %s.%s cannot read label.%s not an lvm device.No VGs to autoactivate.VG %s skip autoactivation.VG %s run autoactivation.autoactivate quickautoactivate slowPV %-*s is in exported VG %s [%s / %s free]PV %-*s VG %-*s %s [%s / %s free]Internal error: Path %s/%s is too long.pvscan[%d] Path %s/%s is too long.pvscan[%d] %s: autoactivation failed.Cannot create online file path for %s %d:%d.pvscan[%d] Cannot create online file path for %s %d:%d.Incomplete online file for %s %d:%d vg %s.pvscan[%d] Incomplete online file for %s %d:%d vg %s.Failed to create online file for %s path %s error %dpvscan[%d] Failed to create online file for %s path %s error %dCannot write online file for %s to %s error %dExisting online file for %d:%dPV %s is duplicate for PVID %s on %d:%d and %d:%d.pvscan[%d] PV %s is duplicate for PVID %s on %d:%d and %d:%d.PV %s has unexpected VG %s vs %s.pvscan[%d] PV %s has unexpected VG %s vs %s.set_pv_devices_online vg %s pv %s missing flag already setset_pv_devices_online vg %s pv %s no online fileWARNING: VG %s PV %s wrong vgname in online file %sVG %s PV %s no device found for %d:%dpvscan[%d] VG %s PV %s no device found for %d:%dset_pv_devices_online vg %s pv %s is online %sWrong VG found for %d:%d PVID %s: %s vs %spvscan[%d] Wrong VG found for %d:%d PVID %s: %s vs %sNo device found for %d:%d PVID %spvscan[%d] No device found for %d:%d PVID %sPVID %s read from %s last written to %s.pvscan[%d] PVID %s read from %s last written to %s.pvscan using %s for PVID %s in VG %sWARNING: Path %s/%s is too long.checking all pvid files using lookup file for %sWARNING: Failed to strdup vgname.pvscan[%d] ignore %s with no lvm info.pvscan[%d] failed to create format instance.pvscan[%d] PV %s has no VG metadata.pvscan[%d] PV %s not found in VG %s.pvscan[%d] PV %s missing device size.pvscan[%d] ignore md component %s.pvscan[%d] PV %s ignore shared VG.Ignore PV %s with VG system id %s with our system id %spvscan[%d] PV %s ignore foreign VG.pvscan[%d] PV %s ignore exported VG.PV %s failed to create online file.pvscan[%d] PV %s failed to create online file.checking all pvid files from vg %srechecking all pvid files from vg %spvscan[%d] VG %s complete after recheck.checking all pvid files from lookup filepvscan[%d] PV %s online, VG unknown.PV %s online, VG %s incomplete (need %d).pvscan[%d] PV %s online, VG %s incomplete (need %d).PV %s online, VG %s is complete.pvscan[%d] PV %s online, VG %s is complete.Cannot list LVs from device without metadata.pvscan[%d] Cannot list LVs from device without metadata.pvscan[%d] Failed to find LVs using %s.pvscan[%d] Failed to check partial lvs.Options -e and -n are incompatibleWARNING: only considering physical volumes %sNo matching physical volumes foundTotal: %d [%s] / in use: %d [%s] / in no VG: %d [%s]Ignoring pvscan --cache -aay because event_activation is disabled.Ignoring pvscan with --checkcomplete because event_activation is disabled.pvscan[%d] Ignoring pvscan with --checkcomplete because event_activation is disabled.Both --major and --minor required to identify devices.pvscan[%d] Failed to create %s %dpvscan_cache_all: label scan allpvscan_cache_all: create list of devicesIgnoring pvscan --cache because event_activation is disabled.pvscan[%d] Failed to set up devices.WARNING: Failed to parse major:minor from %s, skipping.pvscan_cache_args: filter devs nodatapvscan_cache_args: read and filter devspvscan[%d] %s cannot read label.pvscan[%d] %s not an lvm device.%s excluded by devices file (checking PVID).pvscan[%d] %s excluded by devices file (checking PVID).pvscan_cache_args: label scan devspvscan[%d] Failed to initialize processing handle.pvscan[%d] VG %s skip autoactivation.pvscan[%d] VG %s run autoactivation.VG %s not using quick activation.pvscan[%d] VG %s not using quick activation.activation for VG %s failed to lock VG.pvscan[%d] activation for VG %s failed to lock VG.activation for VG %s failed to find vgid.pvscan[%d] activation for VG %s failed to find vgid.activation for VG %s cannot read (%x).pvscan[%d] activation for VG %s cannot read (%x).activation for VG %s found different devices.pvscan[%d] activation for VG %s found different devices.reporter.c in VG sub and its SubLV(s)report_optionsInvalid options string: %s%s: unknown report format.Failed to create log report.No log report stored.Unknonwn report specifier in report option list: %s.Can't report LV and PV fields at the same time in %sreport type "%s"%s%s.Subreport of type "%s" for VG %s contains columns which lead to change of report type. Add these columns to proper subreport type.Merge is in progress, reporting merged LV %s. and also its SubLV(s) with option '-a'WARNING: RaidLV %s needs to be refreshed! See character 'r' at position 9 in the RaidLV's attributes%s.Internal error: _report_all_in_vg: incorrect report typeInternal error: _set_report_prefix_and_name: no prefix found for report type 0x%x_set_report_prefix_and_name: dm_strncpy failedInternal error: _report: unknown report type.Failed to create temporary mempool to process report options.WARNING: devtypes currently ignores command line arguments.Internal error: _do_report: full report requested at incorrect levelInternal error: _do_report: unknown report type.Failed to compact report output.Failed to compact given columns in report output.Failed to add main report section to report group.Failed to finalize main report section in report group.Internal error: _report_all_in_lv: incorrect report typeInternal error: _report_all_in_pv: incorrect report typeInternal error: report_for_selection: incorrect report typeSupported report formats: %s, %s.Failed to create report group.Failed to add log report to report group.Failed to set log report name for command context.Failed to set selection for log report.use_toollib.cunknown Skipping volume group %sfork failed: %sredirect(lvm2)Allocation of vg_name failed.lock_type %s is invalidSetting lock_type to %sDisabling%s pool zeroing.Setting pool discards to %s.Using default stripesize %s.Unknown VDO setting "%s".successInterrupted.Failed to find device "%s".dev_iter creation failed.Selection failed for VG %s.Selection failed for LV %s.Selection failed for PV %s.Processing each VGstrlist allocation failed.Skipping invalid tag: %sInvalid volume group name %s.No volume groups found.Processing VG %s %sRunning command for VG %s %sProcessing LV %s in VG %s.positionProcessing each PVdevice_id_list alloc failed.Cannot use %s: %sProcessing PVs in VG %sProcessing PV %s in VG %s.Skipping PV %s in VG %s.Processing device %s.strdup failed.No PV found on device %s.Can't get device size of %s.No devices to process.Failed to rescan devs exclChecking %s to confirm %.32s.Check confirm arg %s no info.Cannot read orphans VG %s.alloc pvl failed.Creating a new PV on %s.Zeroing start of device %s.%s not wiped: aborting.%s: command failed for %s.Using existing orphan PV %s.Failed to find PV %sMultiple VGs found with the same name: skipping %sUse --select vg_uuid= in place of the VG name.Processing VG %s because of matching UUID %sVG name on command line not found in list of VGs: %sCannot access clustered VG %s.See lvmlockd(8) for changing a clvm/clustered VG to a shared VG.Skipping exported volume group %sCannot access VG %s with system ID %s with %slocal system ID%s%s.Skipping foreign volume group %sCannot process standalone physical volumesCannot process volume group %sCan't initialize PV '%s' without -ff.Can't initialize physical volume "%s" of volume group "%s" without -ffUnable to add physical volume '%s' to volume group '%s'Really INITIALIZE physical volume "%s" of volume group "%s" [y/n]? WARNING: Forcing physical volume creation on %s of volume group "%s"WARNING: Faking size of PV %s. Don't write outside real device.WARNING: %s: device size %s does not match requested size %s. Proceed? [y/n]: PV %s is used by VG %s so please use vgreduce first.(If you are certain you need pvremove, then confirm by using --force twice.)WARNING: PV %s is used by VG %s.Really WIPE LABELS from physical volume "%s" of volume group "%s" [y/n]? WARNING: prompt answer yes is overridden by prompt answer no.%s: physical volume not initialized.%s: physical volume label not removed.WARNING: Wiping physical volume label from %s of volume group "%s".Forking background process from command: %sWARNING: Failed to set SIGCHLD action.Failed to sync local devices before forking.Background process failed to setsid: %sskip_dev_dir: Couldn't split up device name %s."%s": Invalid path for Logical Volume."%s": Invalid environment var LVM_VG_NAME set for Volume Group.Path required for Logical Volume "%s".The clustered option is deprecated, see --shared.Physical extent size must be smaller than %s.Max Logical Volumes may not be negative.Max Physical Volumes may not be negative.VG with system ID %s might become inaccessible as local system ID is %sWARNING: A VG without a system ID allows unsafe access from other hosts.The --shared option requires lock type sanlock, dlm or idm.Found multiple lock managers, select one with --lock-type.Failed to detect a running lock manager to select lock type.Using a shared lock type requires lvmlockd (lvm.conf use_lvmlockd.)Using a shared lock type requires lvmlockd.Skipping activation of cache pool %s.Skipping deactivation of used cache pool %s.Refusing to activate merging volume %s while snapshot volume %s is still active.Cannot fully deactivate merging origin volume %s while snapshot volume %s is still active.Cannot activate LVs in VG %s while PVs appear on duplicate devices.Cannot activate uninitialized integrity LV %s from pvscan.Cannot activate uninitialized integrity LV %s without lock.Updating VG to complete initialization of integrity LV %s.Spawning background pvmove process for %s.Spawning background lvconvert process for %s.Delaying merge for origin volume %s since snapshot volume %s is still active.--ignoremonitoring or --sysinit option not allowed with --monitor option.Setting pool chunk size to %s.Please specify either metadata logical volume or its size.Negative stripesize is invalid.Number of stripes (%d) must be between %d and %d.Ignoring stripesize argument for %s devices.Ignoring stripesize argument with single stripe.Cache mode "writeback" is not compatible with cache policy "cleaner".Ignoring deprecated --vdosettings option "%s" and its value.Invalid argument for VDO setting "vdo_%s".Cannot change VDO setting "vdo_%s" in existing VDO pool.Setting fua and nofua cannot both be set.Setting %s is not recognized. Only one unrecognized setting is allowed.Unrecognized writecache setting "%s" may cause activation failure.Use unrecognized writecache setting? [y/n]: Aborting writecache conversion.Using unrecognized writecache setting: %s = %s.High watermark must be greater than low watermark.Failed to add tag %s to physical volume %s.No physical volume label read from %s.Option --minor may not be repeated.Option -j|--major may not be repeated.Options --major and --minor are incompatible with -Mn.Please specify minor number with --minor when using -My.Please specify major number with --major when using -My.WARNING: Ignoring supplied major number %d - kernel assigns major numbers dynamically. Using major number %d instead.Please use a single volume group name ("%s" or "%s").Logical volume name "%s" is invalid._init_processing_handle: failed to allocate memory for processing handle_init_selection_handle: failed to allocate memory for selection handleObtaining the complete list of VGs to processIgnoring virtual origin logical volume %s.Adding %s to the list of LVs to be processed.Failed to allocate final LV list item.Internal error: Command %d:%s arg position %d does not permit an LV (%llx)Command on LV %s does not accept LV type unknown (%d).Command on LV %s does not accept LV type %s.Command not permitted on LV %s.Command on LV %s has invalid use of option %s.Command on LV %s requires option %s.Command on LV %s uses options invalid with LV type %s.Command on LV %s with invalid LV type %s.Command on LV %s uses options that require LV types %s.Command on LV %s does not accept LV type %s. Required LV types are %s.Command on LV %s uses options that are invalid with LV properties: %s.Command on LV %s is invalid on LV with properties: %s.Command on LV %s uses options that require LV properties: %s.Command on LV %s requires LV with properties: %s.Processing historical LV %s in VG %s.Failed to find logical volume "%s/%s"Processing lockd_sanlock_lv %s/%s.One LV position arg is required.VG name mismatch from %s arg (%s) and option arg (%s).Cannot find VG name for LV %s.Obtaining the complete list of VGs before processing their LVsTags cannot be used with this command.Cannot use PV %s in exported VG %s.Cannot use PV %s in foreign VG %s.Cannot use PV %s in shared VG %s.Processing duplicate device %s.Internal error: No info for pvidFailed to find physical volume "%s".Processing devices that are not PVslabelsector must be less than %lu.metadataignore only applies to metadatacopies > 0.Physical volume data alignment may not be negative.Physical volume data alignment is too big.Physical volume data alignment offset may not be negative.Physical volume data alignment offset is too big.WARNING: Ignoring data alignment %s incompatible with restored pe_start value %s.Metadata size may not be negative.Bootloader area size may not be negative.Scanning and filtering device args (%u).Command requires all devices to be found.WARNING: Unknown block size for device %s.WARNING: Unknown logical_block_size for device %s.WARNING: Devices have inconsistent physical block sizes (%u and %u).See lvm.conf allow_mixed_block_sizes.Checking %s for pvremove %.32s.Check pvremove arg %s no PVID foundCheck pvremove arg %s device is not a PV.Check pvremove arg %s found vg %s.Check pvremove arg %s found EXT_USED flag.Check pvremove arg %s is orphan.Checking %s for pvcreate %.32s.Check pvcreate arg %s no PVID foundCannot use device %s with duplicates.Failed to read lvm info for %s PVID %s.Check pvcreate arg %s found vg %s.Check pvcreate arg %s found EXT_USED flag.Check pvcreate arg %s is orphan.UUID %s already in use on "%s".Check pvremove arg %s device is a duplicate.Failed to reacquire global lock after prompt.Rescanning and filtering device args with exclusive openCheck confirm arg %s no PVID foundCannot use device %s: it changed during prompt.Wiping signatures on new PV %s.Using existing orphan PVs in %s.Failed to wipe existing label on %s.Writing physical volume data to disk "%s".Failed to write physical volume "%s".Physical volume "%s" successfully created.Failed to wipe existing label(s) on %s.Labels on physical volume "%s" successfully wiped. 0Ib{/Ck""%5N|)BZs \/dev/nullPhysical extent size may not be negative.Failed to allocate filename.vgcfgbackup.cError processing filename template %sVGs must be backed up into different files. Use %%s in filename for VG name.No backup taken: specify filename with -f to backup with missing PVs.No backup taken: specify filename with -f to backup with unknown segments.Volume group "%s" successfully backed up.vgcfgrestore.cNo devices found.Restore aborted.Restore failed.Restored volume group %s.Volume group %s has active volume: %s.Volume group name "%s" is invalid.Please specify a *single* volume group to restore.Internal error: VG name is not set.WARNING: Failed to check for active volumes in volume group "%s".WARNING: Found %u active volume(s) in volume group "%s".Restoring VG with active LVs, may cause mismatch with its metadata.Do you really want to proceed with restore of volume group "%s", while %u volume(s) are active? [y/n]: Unable to lock volume group %s.vgchange.c(no profile)Failed to deativate %s.Unable to set system ID.DeaRefreshing volume group "%s"No volume groups changed.VG lock type not changed.No global lock for lock startautonowaitVolume group autoactivation is already %s.Changing configuration profile for VG %s: %s -> %s.vgchange_metadata_copies new %u vg_mda_copies %u D %uNumber of metadata copies for VG %s is already unmanaged.Number of metadata copies for VG %s is already %u.Volume group "%s" is already resizeableVolume group "%s" is already not resizeableVolume group allocation policy is already %sVolume group has active logical volumesFailed to generate new random UUID for VG %s.Physical extent size cannot be larger than %s.Physical extent size of VG %s is already %s.Failed to change physical extent size for VG %s.New lock type %s matches the current lock type %s.Cannot change lock type directly from "%s" to "%s".First change lock type to "none", then to "%s".Changing VG %s lock type not allowed with active LVsFailed to initialize lock args for lock type %sCannot change to unknown lock type %sVolume group "%s" successfully changedIgnoring invalid string in lock_start listIgnoring empty string in config fileNot starting %s since it does not pass lock_start_listNot starting %s since it does not pass auto_lock_start_listVolume Group system ID is already "%s".WARNING: Removing the system ID allows unsafe access from other hosts.Remove system ID %s from volume group %s? [y/n]: System ID of volume group %s not changed.Logical Volumes in VG %s must be deactivated before system ID can be changed.WARNING: Requested system ID %s does not match local system ID %s.WARNING: No local system ID is set.WARNING: Volume group %s might become inaccessible from this machine.Set foreign system ID %s on volume group %s? [y/n]: Volume group %s system ID not changed.Changing system ID for VG %s from "%s" to "%s".Starting background polling for volume group "%s".Background polling started for %d logical volume(s) in volume group "%s"Autoactivation is disabled for VG %s.Can't deactivate volume group "%s" with %d open logical volume(s)%d logical volume(s) in volume group "%s" already active%d existing logical volume(s) in volume group "%s" %smonitored%sctivated %d logical volumes in volume group %s.Failed to sync local devices for VG %s.%d logical volume(s) in volume group "%s" now active%d logical volume(s) in volume group "%s" %smonitoredNeed one or more command options.Only one of --metadataprofile and --detachprofile permitted.Only one of -a and --refresh permitted.Only -a permitted with --ignorelockingfailure and --sysinitOnly -ay* allowed with --monitor or --poll.Only one of --poll and --sysinit permitted.MaxPhysicalVolumes may not be negativePhysical extent size may not be negativeChange clustered property of all volumes groups? [y/n]: Lock type can only be forced to "none" for recovery.Forcibly change VG lock type to none? [y/n]: Using lock type requires lvmlockd.Using lock start and lock stop requires lvmlockd.Starting locking. Waiting for sanlock may take 20 sec to 3 min...Starting locking. Waiting until locks are ready...Starting locking. VG can only be read until locks are ready.vgck.cFailed to write VG.Failed to commit VG.The volume group is missing %d physical volumes. with system ID vgcreate.cFailed to get tagFailed to start lockingPlease provide volume group name and physical volumesA volume group called %s already exists.WARNING: Setting maxlogicalvolumes to %d (0 means unlimited)WARNING: Setting maxphysicalvolumes to %d (0 means unlimited)Volume group "%s" successfully created%s%sStarting locking. VG is read-only until locks are ready.--- Physical volumes ---vgdisplay.cOption -A is not allowed with volume group namesVolume group "%s" has active logical volumesLV %s/%s must be inactive on all hosts before vgexport.Volume group "%s" successfully exportedPlease supply volume groups or use --select for selection or use -a for all.No arguments permitted when using -a for all.vgexport.cVolume group "%s" will be extended by %d new physical volumesVolume group "%s" successfully extendedWARNING: PV %s not found in VG %sWARNING: The PV %s is still missing.WARNING: PV %s was not missing in VG %sPlease enter volume group name and physical volume(s)Volume group %s not changedvgextend.cNo PV has been restored.Volume group "%s" is not exportedVolume group "%s" is partially missingVolume group "%s" successfully importedPlease supply volume groups or -S for selection or use -a for all.WARNING: Volume groups with missing PVs will be imported with --force.vgimport.cvgimportclone.cFailed to find device %s.scan new devsDevice %s is excluded: %s.No VG found on devices.get other devicesscan other devicesBase vg name %s is too long.%s1%s%uUsing new VG name %s.import vg on new devicesCan't get lock for VG name %sVG is missing a device.Failed to write devices file.Devices file not enabled, ignoring importdevices.Devices file does not exist, ignoring importdevices.Failed to find PVID for device %s.Devices must be from the same VG.Internal error: Old vg name %s is too long.Temporary vg name %s1 is too long.Failed to generated temporary vg name, %s%u is too long.Can't get lock for new VG name %sFailed to read VG %s from devices being imported.Error reading VG %s from devices being imported.VG %s is exported, use the --import option.VG %s is partial, it must be complete.Device %s has active LVs, deactivate first.PV with UUID %s is part of VG %s, but is not included in the devices to import.All PVs in the VG must be imported together.Device %s was not found in VG %s.The devices to import must match the devices in the VG.Failed to add device id for %s.Failed to update VG on devices being imported.Not importing devices for VG %s with missing PV %s.Failed to write device ids in VG metadata.Failed to set up devices file.Failed to create devices file.Failed to write the devices file.Added %u devices to devices file.vgimportdevices.cNo devices to add.Checking for volume group "%s"vgmerge not allowed for lock_type %sPlease enter 2 or more volume groups to mergeDuplicate volume group name "%s"Removing pool metadata spare %s.Failed to generate new random LVID for %sWriting out updated volume groupVolume group "%s" successfully merged into "%s"vgmerge.cChanged LVID for %s to %svgmknodes.cWARNING: Partial LV %s needs to be repaired or removed. There are still partial LVs in VG %s.To remove them unconditionally use: vgreduce --removemissing --force.To remove them unconditionally from mirror LVs use: vgreduce --removemissing --mirrorsonly --force.WARNING: Proceeding to remove empty missing PVs.Volume Groups must always contain at least one PV.Removing PV with UUID %s from VG %s.LVs still present on PV with UUID %s: Can't remove from VG %s.Non-mirror-image LV %s found: can't remove.WARNING: Removing partial LV %s.Failed to write out a consistent VG for %sPlease give volume group name and physical volume paths.Please give volume group name.--mirrorsonly requires --removemissing.Please enter physical volume paths or option -a.Option -a and physical volume paths mutually exclusive.Please only specify the volume group.Volume group "%s" is already consistent.Wrote out consistent volume group %s.vgreduce.cWARNING: %d physical volumes are currently missing from the system.Do you really want to remove volume group "%s" containing %u logical volumes? [y/n]: Please enter one or more volume group paths or use --select for selection.vgremove.cVolume group "%s" not removedCan't get lock for %svgrename.cRenaming "%s" to "%s"Test mode: Skipping rename.Renaming "%s" to "%s" failedNew VG name must differ from the old VG name.New VG name "%s" already existsNew VG name "%s" matches the UUID of existing VG %sRenaming path is too long %s/%s %s/%sVolume group "%s" successfully renamed to "%s"Old and new volume group names need specifyingexported vgscan.cFound %svolume group "%s" using metadata type %sCannot notify dbus: lvm is not built with dbus support.Cannot notify dbus: notify_dbus is disabled in lvm config.Ignoring vgscan --cache command because lvmetad is no longer used.Logical volume %s (part of %s) must be inactive.Logical volume %s must be inactive.Can't split LV %s between two Volume GroupsExisting VG, new VG and either physical volumes or logical volume required.A logical volume name cannot be given with physical volumes.Failed to lock new VG name %s.Volume group "%s" exists, but new VG option specifiedCan't split Logical Volume %s between two Volume GroupsCan't split mirror %s between two Volume GroupsCan't split external origin %s and pool %s between two Volume Groups.Can't split pool data and metadata %s between two Volume Groups.Cannot split cache origin %s and its cache pool data %s into separate VGs.Cannot split cache origin %s and its cache pool metadata %s into separate VGs.Cannot split cache pool data %s and its metadata %s into separate VGs.Cannot split cache origin %s and its cachevol %s into separate VGs.Can't split snapshot %s between two Volume GroupsCannot split: Nowhere to store metadata for new Volume GroupWriting out updated volume groupsVolume group "%s" became inconsistent: please fix manually%s volume group "%s" successfully split from "%s"vgsplit.cExistingNewInvalid vg name %s.Failed to create new VG %s.Failed to read VG %s.Physical Volume %s not foundHandle initialisation failed.lvmcmdlib.cCmdline copy failed.No command supplied_memlock_inc_memlock_dec_dmeventd_thin_command_dmeventd_vdo_commandToo many arguments. Limit is %d.config-util.cFailed to duplicate node key.%t%.*s= %ld %.*s= "%s" %b%.*s%sInternal error: Bad format string '%s'Internal error: Bad format string at '%s'Internal error: Do not use %%d and use correct 64bit form end %dInternal error: Message response doesn't contain terminating NUL characterFailed to mangle new device UUID "%s"New device uuid mangled [%s]: %s --> %sdm_task_set_newuuid: strdup(%s) faileddm_task_set_message: strdup faileddm_task_set_geometry: sprintf failedTarget type name %s is too long.create_target: malloc(%zu) failedcreate_target: strdup(params) failedcreate_target: strdup(type) failedInternal error: unknown device-mapper task %dFailed to revert device creation.Failed to create device-mapper task structreload %u:%u diff start %llu %llu type %s %sreload %u:%u diff length %llu %llu type %s %sreload %u:%u diff params ignore for type %sreload %u:%u diff params for type %sInternal error: Performing unsafe table load while %d device(s) are known to be suspended: %s%s%s %s%.0d%s%.0d%s%sInternal error: dm '%s' ioctl should not define parameters.targets and message are incompatibletargets and rename are incompatibletargets and geometry are incompatiblemessage and rename are incompatiblegeometry and rename are incompatiblegeometry and message are incompatiblemessage is required with sectorOverriding major number of %d with %u for persistent device.Missing major number for persistent device.device (%u:%u) is %s for compatibility with old kernelUnable to find name for device (%u:%u)No flush flag unsupported by kernel. Buffers will be flushed.Secure data flag unsupported by kernel. Buffers will not be wiped after use.WARNING: Inactive table query unsupported by kernel. It will use live table.WARNING: Setting UUID unsupported by kernel. Aborting operation.WARNING: IMA measurement unsupported by kernel. Aborting operation.Ran out of memory building ioctl parameterCouldn't create ioctl argument.Cookie value is not set while trying to call %s ioctl. Please, consider using libdevmapper's udev synchronisation interface or disable it explicitly by calling dm_udev_set_sync_support(0).Switching off device-mapper and all subsystem related udev rules. Falling back to libdevmapper node creation.dm %s %s%s %s%s%s %s%.0d%s%.0d%s%s[ %s%s%s%s%s%s%s%s%s%s] %.0lu %s [%u] (*%u)device-mapper: %s ioctl on %s %s%s%.0d%s%.0d%s%s failed: %sUevent not generated! Calling udev_complete internally to avoid process lock-up.WARNING: libdevmapper buffer too small for dataAttempting to suspend a device that is already suspended (%u:%u)Internal error: Attempt to suspend device %s%s%s%.0d%s%.0d%s%sthat uses already-suspended device (%u:%u)Failed to get device-mapper versionIncompatible libdevmapper %s%s and kernel driver %s.Hold of control device is now %sset.libdevmapper exiting with %d device(s) still suspended.o ؠnnn [trust_udev] [verify_udev]device_mapper/libdm-common.c%s: %s NODE_DEL%s%s%s: %s NODE_RENAME to %s%s%sDM_DEBUG_WITH_LINE_NUMBERS%s:%d #+-.:=@_selabel_open failed: %sFailed to build sysfs_path.%s/block/bdiqueueuremovableslavetraceuevent%sblock/%s/%s/devsemid %d: semctl failed: %sUnstackingStackingDM_DEFAULT_NAME_MANGLING_MODE1.02.181-RHEL8 (2021-10-20)\x5cx\x%02xName "%s" too long.Couldn't create path for %sDevice %s not found%s/../%s%2x%sName "%s" too longSELinux context resetsetfscreateconlsetfilecon%s (%d:%d): read ahead is %uBLKRAGET%s: read ahead is %uNew uuid prefix %s too long.%*u %*u %u:%u %4096s %4096s%sdev/block/%u:%u/dm/name%sdev/block/%u:%u%sdev/block/%u:%u/holders%sfs%sfs/%s/%sFailed to get driver versionDM udev checking enabledDM udev checking disabled%s: mknod for %s failed: %schownCreated %sRemoved %sRenamed %s to %sProcessingFailed to build size in kB.BLKRASETSkipping SUBSYSTEM_7 SUBSYSTEM_6 SUBSYSTEM_5 SUBSYSTEM_4 SUBSYSTEM_3 SUBSYSTEM_2 SUBSYSTEM_1 SUBSYSTEM_0 PRIMARY_SOURCE DISABLE_LIBRARY_FALLBACK LOW_PRIORITY DISABLE_OTHER_RULES DISABLE_DISK_RULES DISABLE_SUBSYSTEM_RULES DISABLE_DM_RULESCREATERELOADREMOVE_ALLINFODEPSWAITEVENTLISTCLEARMKNODESLIST_VERSIONSTARGET_MSGSET_GEOMETRY%s: %s NODE_ADD (%u,%u) %u:%u 0%o%s%s%s: %s NODE_READ_AHEAD %u (flags=%u)%s%sselabel_lookup failed for %s: %sCouldn't create path for %s/%s.semid %d: sem_ctl GETVAL failed for cookie 0x%x: %ssemid %d: semop failed for cookie 0x%x: incorrect semaphore statesemid %d: semop failed for cookie 0x%x: %sUdev cookie 0x%x (semid %d) decremented to %dCould not cleanup notification semaphore identified by cookie value %u (0x%x): %sUdev cookie 0x%x (semid %d) destroyedFailed to open /dev/urandom to create random cookie valueFailed to initialize notification cookieNot enough memory to create notification semaphoreLimit for the maximum number of semaphores reached. You can check and set the limits in /proc/sys/kernel/sem.Failed to create notification semaphore: %sUdev cookie 0x%x (semid %d) createdUdev cookie 0x%x (semid %d) incremented to %dKernel not configured for semaphores (System V IPC). Not using udev synchronisation code.Udev is not running. Not using udev synchronisation code.Could not get udev state. Assuming udev is not running.Udev is running and DM_DISABLE_UDEV environment variable is set. Bypassing udev, device-mapper library will manage device nodes in device directory.Could not continue to access notification semaphore identified by cookie value %u (0x%x). Incorrect cookie prefix.Could not find notification semaphore identified by cookie value %u (0x%x)No permission to access notificaton semaphore identified by cookie value %u (0x%x)Failed to access notification semaphore identified by cookie value %u (0x%x): %sInvalid directory value, %s: not an absolute name.Invalid directory value, %s: name too long.Failed to build dev path for "%s".Insufficient memory to stack mknod operationSuspended device counter increased to %dAttempted to decrement suspended device counter below zero.Suspended device counter reduced to %ddm_task_create: malloc(%zu) failedThe %s "%s" seems to be mangled more than once. This is not allowed in auto mode.Internal error: mangle_string: supplied buffer too smallThe %s "%s" contains mixed mangled and unmangled characters or it's already mangled improperly.Mangled form of the %s too long for "%s".Failed to mangle device name "%s".Device name mangled [%s]: %s --> %s_dm_task_set_name: strdup(%s) failedName "%s" invalid. It contains "/".Couldn't create /dev path for %s_task_get_string_mangled: strdup failedInternal error: unmangle_string: supplied buffer too smallThe %s "%s" should be mangled but it contains blacklisted characters.Hex encoding mismatch detected in %s "%s" while trying to unmangle it._task_get_string_unmangled: strdup failedFailed to unmangle device name "%s".Failed to mangle device uuid "%s".Failed to unmangle device uuid "%s".Non empty new name is required.Failed to mangle new device name "%s"New device name mangled [%s]: %s --> %sdm_task_set_newname: strdup(%s) failedDevice uuid mangled [%s]: %s --> %sdm_task_set_uuid: strdup(%s) failedPreparing SELinux context for %s to %s.Resetting SELinux context to default value.Setting SELinux context for %s to %s.%sdev/block/%u:%u/bdi/read_ahead_kbEmpty device name passed to BLKRAGETFailed to parse mountinfo line.Mount info task creation failed.Replacing mountinfo device (%u:%u) with matching DM device %s (%u:%u)._sysfs_get_dm_name: failed to allocate temporary buffers_sysfs_get_dm_name: dm_snprintf failed_sysfs_get_dm_name: supplied buffer too small_sysfs_get_kernel_name: failed to allocate temporary buffers_sysfs_get_kernel_name: dm_snprintf failedCould not locate device kernel name in sysfs path %s_sysfs_get_kernel_name: output buffer too smallDevice %s (%u:%u) appears to be mounted on %s.WARNING: sysfs_path dm_snprintf failed.Failed to set a proper state for notification semaphore identified by cookie value %u (0x%x) to initialize waiting for incoming notifications.Udev cookie 0x%x (semid %d) waiting for zeroCould not set wait state for notification semaphore identified by cookie value %u (0x%x): %sA non-block device file at '%s' is already presentUnable to unlink device node for '%s'%s not set up by udev: Falling back to direct node creation.Node %s was not removed by udev. Falling back to direct node removal.The node %s should have been renamed to %s by udev but old node is still present. Falling back to direct old node removal.The node %s should have been renamed to %s by udev but new node is not present. Falling back to direct node rename.Unable to rename device node from '%s' to '%s'%s: retaining kernel read ahead of %u (requested %u)%s (%d:%d): Setting read ahead to %uCould not set notification semaphore identified by cookie value %u (0x%x)Udev cookie 0x%x (semid %d) assigned to %s task(%d) with flags%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s (0x%x)Could not signal waiting process using notification semaphore identified by cookie value %u (0x%x)((8HXhx/proc/self/mountinfoWARNING: Ignoring unsupported value for %s.%s not found in config: defaulting to "%s"%s not found in config: defaulting to %ld%s not found in config: defaulting to %fvsnprintf failed for config linedm_vasprintf failed for config linedm_pool_grow_object failed for config line_write_value: Unknown value type: %dFailed to clone config string value.WARNING: Ignoring duplicate config node: %s (seeking %s)Parse error at byte %td (line %d): expected a string token.WARNING: Invalid creation_time found in metadata (repaired with next metadata update).Parse error at byte %td (line %d): unexpected tokenParse error at byte %td (line %d): expected a valueParse error at byte %td (line %d): empty section identifierWARNING: Ignoring duplicate config value: %sdm_pool_begin_object failed for config line%s not found in config: defaulting to %dFailed to allocate config pool.Failed to allocate config tree.Cannot clone NULL config node.Failed to clone config node key.Failed to create config node's key.device_mapper/libdm-config.c%f0%lotruefalseFailed to clone config value.Failed to duplicate token.Failed to allocate type valueFailed to read int token.Failed to read float token.Failed to allocate value%s}[%s,%sconfig_outputFailed to clone config node.Failed to create config node.pI-(hP _create_dm_tree_node alloc failed.dtree node hash insertion faileddtree uuid hash insertion failed_info_by_dev: Failed to set device number.Deactivation dm_task creation failed for %sFailed to set device number for %s deactivationFailed to set message major minor.Failed to process message "%s".WARNING: Can't set no_flush flag.Suspend dm_task creation failed for %s.Failed to set device name for %s resumption.Failed to set device number for %s resumption.WARNING: Failed to set read ahead.Device id %u is higher then %u.Expected thin-pool target for %s and got %s.Found transaction id %lu for thin pool %s with status line: %s.dtree node segment allocation failedFailed to allocate target segment area._deps: failed to set major:minor for (%u:%u)._deps: failed to set inactive table for (%u:%u)_deps: task run failed for (%u:%u)_deps: failed to get info for (%u:%u)Inconsistent dtree major number: %u != %uInconsistent dtree minor number: %u != %uNode %s must have only one segment.Expected vdo target for %s and got %s.VDO needs message for compression %u(%u) and deduplication %u(%u).Failed to format %s device number for %s as dm target (%u,%u)WARNING: Ignoring RAID1 stripe sizeFailed to get %s target versionsReload dm_task creation failed for %s.Failed to set device number for %s reload.Failed to set read only flag for %s.Insufficient space for target parameters.Can create VDO data volume path for %s.Correcting VDO virtual volume size from %lu to %lu.V4 %s %lu %u %lu %u deduplication %s compression %s maxDiscard %u ack %u bio %u bioRotationInterval %u cpu %u hash %u logical %u physical %u%s 0 %u %s %d fix_padding block_size:%u internal_hash:%sNo parameters supplied for %s target %u:%u.Adding target to (%u:%u): %lu %lu %s %sTarget parameter size too big. Aborting.WARNING: Failed to suppress reload of identical tables.Suppressed %s identical table reload.Table size changed from %lu to %lu for %s.%sResume of table of extended device %s delayed.Insufficient space in params[%zu] for target parameters.dtree uuid hash creation failedResetting %s udev_flags from 0x%x to 0x%x.Thin pool %s transaction_id matches %lu, skipping messages.Thin pool %s transaction_id is %lu, while expected %lu.Cannot send messages to thin pool %s%s%s%s.Thin pool %s already contain thin device with device_id %u.Manual intervention may be required to remove device dev_id=%u in thin pool metadata.Optionally new thin volume with device_id=%u can be manually added into a volume group.WARNING: When uncertain how to do this, contact support!Thin pool %s transaction_id is %lu and does not match expected %lu.Matched uuid %s (missing suffix -%s) in deptree.Matched uuid %s (missing prefix) in deptree.Not matched uuid %s in deptree.Couldn't find snapshot origin uuid %s.Couldn't find snapshot COW device uuid %s.Couldn't find merging snapshot uuid %s.Cannot add device without name and uuid._node_clear_table failed: missing nameFailed to obtain dependencies for %s before clearing table.Clearing inactive table %s (%u:%u)Table clear dm_task creation failed for %sFailed to set device number for %s table clear_node_clear_table failed: info missing after running task for %sFailed to deactivate no-longer-used device %s (%u:%u)Sent messages to thin-pool %s and skipping suspend of its children.Suspend dm_task creation failed for %sFailed to set device number for %s suspension.WARNING: Failed to set skip_lockfs flag.WARNING: Failed to set no_flush flag.Unable to deactivate open %s (%u:%u).Node %s %d:%d has open_count %dUnable to deactivate %s (%u:%u).Rename dm_task creation failed for %sFailed to set name for %s rename.Failed to rename %s (%u:%u) to %sCreate dm_task creation failed for %sFailed to set device name for %sFailed to set device number for %s creation.Failed to set read only flag for %sInternal error: Unable to get DM task info for %s.WARNING: Failed to get uuid for dtree node %s.Couldn't find mirror log uuid %s.Unsupported cache's feature flags set %lu.Invalid cache's feature flag %lu.Data block size %u is lower then %u sectors.Data block size %u is higher then %u sectors.Missing cache's metadata uuid %s.Missing cache's origin uuid %s.Cache policy parameter %s is without integer value.Missing writecache's cache uuid %s.Missing writecache's origin uuid %s.Missing integrity's meta uuid %s.Missing integrity's origin uuid %s.Replicator segment is unsupported.Replicator targer is unsupported.Failed to allocate thin message.Cannot use same device id for origin and its snapshot.New transaction id must be sequential.Current transaction id is different from thin pool.Missing thin external origin uuid %s.dm_tree_node_add_target_area called without deviceDevice %s is not a block device.dm_tree_node_add_null_area() called on an unsupported segment typedevice_mapper/libdm-deptree.cname pool_strdup failedRemoving %s (%u:%u)Failed to set major minor.Resuming %s (%u:%u).no targetdtree link allocation failedNode %s is missing a segment.Node %s has segment type %s.compression oncompression offindex-enableindex-disableParsing VDO status: %s%s%s %lu%s %d %u nosync rebuild %u min_recovery_rate %u max_recovery_rate %u write_mostly %u max_write_behind %u region_size %u raid10_copies %u delta_disks %d data_offset %d read_only error_if_no_space no_discard_passdown ignore_discard skip_block_zeroing (Ignoring.)Loading table for %s.clustered-userspace %u %s clustered-%s%s %u 1 handle_errors%s %s %c %d%u %u /dev/dm-%uV2 %s %lu %u %lu %u %s %s %s %s%s%s%s%s %s %lu %s %s %d %lu %d%s%s%s%s%s%s %d%s metadata2 passthrough writeback writethrough migration_threshold %u %s %lu%s %s %s %u %d high_watermark %llu low_watermark %llu writeback_jobs %llu autocommit_blocks %llu autocommit_time %llu fua nofua cleaner max_age %u meta_device:%s recalculate journal_sectors:%u ineterleave_sectors:%u buffer_sectors:%u journal_watermark:%u commit_time:%u bitmap_flush_interval:%u sectors_per_bit:%lludtree hash creation failedFailed to allocate dtree. in failed state which needs check first with read only metadataUUID "%s" does not match.create_snap %u %ucreate_thin %udelete %uset_transaction_id %lu %lureserve_metadata_snaprelease_metadata_snapMatched uuid %s in deptree.Dropping callback for %s.Reverting %s.Unable to deactivate %s. with device flush with filesystem syncSuspending %s (%u:%u)%s%sUnable to suspend %s (%u:%u)is used by another deviceconstains a filesystem in useDevice %s (%u:%u) %s.Renaming %s (%u:%u) to %sUnable to resume %s.Creating %sFailed to set uuid for %slog uuid pool_strdup failedUnsupported raid type %s.Missing cache's data uuid %s.No integrity meta uuid.Missing metadata uuid %s.Ignoring %lu of device.Missing pool uuid %s.Unsupported message type %d.Missing thin pool uuid %s.Couldn't find area uuid %s.Missing VDO's data uuid %s.p?Dt=t=B ?B ?Bt=0BH@><='). [time]After specified time (same as '>'). [time]Until specified time (same as '<='). [time]Before specified time (same as '<'). [time]device_mapper/libdm-report.ctype-specificfield-specific": [string listunselectable %s Fields%*.*s %sall%-*s - %sAll fields in this section. %-*s - %s%s%s%s%sSelection operandsReserved values %-*s - %s [%s]Selection operators------------------- Comparison operators: %6s - %s %4s - %sUnsupported selection type%-*.*s\Missing end quote.%s: field name too long.Unrecognised field: %.*sExpecting field nameMissing value after operatorSpecified month out of range.Specified day out of range.Specified hours out of range.report selectionExpecting logical operatordm_report_init: malloc failedreport_groupShow help.Specialspecial_&&All fields must match||At least one field must matchLogical negationLeft parenthesisRight parenthesisList startList endList subset startList subset end=~!~!=>=<=sinceuntiln~Incorrect time format.Incorrect date format.Failed to parse string list value for selection field %s._display_selection_help: dm_pool_grow_object failedSyntax error: right parenthesis expected at '%s'Syntax error: left parenthesis expected at '%s'?= # and <#devices> and Failed to parse %sraid params: %s %u %lu/%lu %u %lu/%lu %lu %lu %lu %lu %lu %lu %lu %dFailed to parse cache params: %sFailed to parse writecache params: %s.Failed to parse integrity params: %s.Failed to parse invalid thin params.Failed to parse thin pool params: %s.Failed to allocate thin_pool status structure.Failed to allocate thin status structure.Failed to parse thin params: %s.Failed to alloc mem pool to parse mirror status.Internal error: More then 8 reported in mirror status.Allocation of log type string failed.Failed to parse mirror status %s.device_mapper/libdm-targets.c%lu/%lu %luInvalidMerge failedOverflow<#devs> %s %u %s %lu/%luErrorFailwritethrough writeback passthrough metadata2 no_discard_passdown Unknown feature in status: %s%d ro needs_check%llu %llu %llu %llu%llu %llu %s%lu %lu/%lu %lu/%lu%nout_of_data_spacero Allocation of devs failed.%u:%u %nuserspaceAllocation of logs failed.get_timestampclock_gettimedevice_mapper/libdm-timestamp.cOut of memory. Requested %zu bytes.Couldn't create memory pool %s (size %zu)Internal error: pool_free asked to free pointer not in poolYou have a memory leak (not released memory pool):Internal error: Unreleased memory pool(s) found.Internal error: Pool %s is already locked.Internal error: Pool %s is already unlocked.Internal error: Pool %s crc mismatch.device_mapper/mm/pool-fast.cdevice_mapper/mm/pool.c [%p] %sPool %s is locked.Pool %s is unlocked.device_mapper/regex/matcher.c(.*(%s)%c)Couldn't parse regexregex fingerprint(rx->type != OR) || (rx->left && rx->right)Internal error: Unknown calc node typetsrts_fill_tableIncomplete rangespecificationBadly formed 'or' expressionParse error in regexRegex optimisation errordevice_mapper/regex/parse_rx.cBadly quoted character at end of expressionmissing ')' in regular expressionRegex charset allocation failed}xxx}}}}xx}xxxxxxxxxxxxxxxx}xxxxxxxxxxxxxxxxxxxxxxxxxxx8~(xP}xxxxxxxxxxxxxxxxxxxxxxxxxxxxx}|| |device_mapper/regex/ttree.ccouldn't get token for '%s'couldn't parse '%s'out of memorycouldn't get token for deviceoperating modeindex statecompression stateused blockstotal blockstoo many tokensrecoveringread-onlynormalerrorclosedopeningclosingofflineonlineunknownonlineofflinefstatdevice_mapper/vdo/vdo_reader.cFailed to open VDO backend %s.Found mismatching VDO magic header in %s.Expected geometry VDO block instead of block %u.Unsupported VDO version %u.%u.File/Device is shorter and can't provide requested VDO volume region at %lu > %lu.Unknown VDO component version %u.VDO metadata has mismatching VDO nonces %lu != %lu.dmvdo001VDO minimum io size %u is unsupported [512, 4096].device_mapper/vdo/vdo_target.cVDO block map cache size %u MiB is out of range [%u..%u].VDO block map era length %u is out of range [%u..%u].VDO index memory size %u MiB is out of range [%u..%u].VDO slab size %u MiB is out of range [%u..%u].VDO max discard %u is out of range [%u..%u].VDO ack threads %u is out of range [0..%u].VDO bio threads %u is out of range [%u..%u].VDO bio rotation %u is out of range [%u..%u].VDO cpu threads %u is out of range [%u..%u].VDO hash zone threads %u is out of range [0..%u].VDO logical threads %u is out of range [0..%u].VDO physical threads %u is out of range [0..%u].Internal error: VDO write policy %u is unknown.Value of vdo_hash_zone_threads(%u), vdo_logical_threads(%u), vdo_physical_threads(%u) must be all zero or all non-zero.VDO logical size is larger than limit %lu TiB by %lu KiB.Failed to allocate memory for hash.Failed to allocate slots for hash.base/data-struct/hash.cbase/data-struct/list.chead->nhead1->ndm_list_splicedm_list_add_hdm_list_add0 P`hP,K_ݧ#8Ppث((@@_dump_degrade_to_n48_degrade_to_n16_degrade_to_n4unused value is not UNSET (n4) unused value is not UNSET (n16) referencing value past nr_entries (n48) not all values are referenced (n48) incorrect number of entries in n48, n48->nr_entries = %u, actual = %u unused value is not UNSET (n48) incorrect number of entries in n256, n256->nr_entries = %u, actual = %u ./base/data-struct/radix-tree-adaptive.cincorrect entry count: rt->nr_entries = %u, actual = %u duplicate entry (n48) %u value in UNSET (n48) unknown value type: %u shouldn't get here n4 != NULLn16 != NULLn48 != NULL values[i].type != UNSEThtAtBtC8uDuEuEuF v0H@v@IvPJvKvN4wOw0QwRxR?@CؠCPE@ElPGHI80JpJL̢@LM@@NtO@Q$0SxY̤[ ]l]P^ܥp_add@sħtpt0yx zĨzp{d{||ܩ } P p̪0@@TPh`|p4p0З@PpHȮܮPХph@̯P0D` `h زpLlPpд p\ @T08L Է@4|PPHpP@,x`Ļػ(<PhP,@Tн pl@p< 0@ĿpDPp8@`Hp (0 @ l 0 L `0@X` P ,h0 $!``"#`##40$P$`%)X*`+,0@,L//P0P2034 5 545l5707P848tP9p999;<?A(DFMp@QpU\pVVW[\aaa0Pbhbfi`it ill mXmor8rL@sppssst0tuLu|x@x yy$} 4L`p0p$8L`x@И`p @P@tX$PHp\p<(h `  HX ,H0H 0@ l(TPxp  d0L ##`'P()0111120222 3H5@5556 `:p:0;;`<0=P= 0>H>x ?`??@D`B@FG<0I`a,bch@jj0k k8kd mx`qqqqr$rH sh@sttu( vTv0wxy4Pyl@|}( ~H0@@p`p @p``@0PP0H0dPЖ`(HЗ\pP @ 0\ М 0 $  < P| @   0 `L p` `    0$ @8   P \p@00@hPp0LP  4Hl`$0`0P$Pp` h8d Xl P ` p   $P @p`p0@@"\P*,\p//00,1dP6p666 6 8T @9 9 @=@!=T!=h!>|!`J# M$`M$N%Q%@T%pU%U& X&[&[,'\x'0]']'0_(`x(e0)e)m*pnH*0ot*u*+,0-|-P-$.Д8.L.`.@t.P...|0 0 101Ц1 102@$2022223@3Ь33p4\5t5`55`6,6X66н6` 7L70h7077`8P8l888 88 9 9`d:P::;;h;|;;X<0<@<`===@> 4>0>>`>?ṗp?| P@d00dē( Ȕ 0 h@@p0З\0p hP|@̚ P,d`ț0@pThЦ|@`Э<08вȟ,@ pԠ$<t`ܡHp@Pd` 40P@(p\̦$8|ܧ<`  (`@p < $<PX04l4556 8<=p>0>X@pEFHPI|IIJشK(PL`MOpPPD@XZ `[0[D\d\]^,^@_hhܸjDplmo` t wyX{|0p}H}`~0̽ h0ľp(Կ \`0 XtХ@ ` 4H\p @PЧ (0<@PPd`xp0@p 4H0l@`LЭp`(``(t,lPp0P`P lh`$0P  00`|@P8ppT p\ ` hXP`t0@1`12D2`36;d?P?pBhB|BBBC0CPCpCCC0CDCXDl0DPDpDDDDDE 0E ExFJTpKtKKKL@MLPO_tPee,lxrsHsh ty@zz {|$P|D|dp@p  h|  Г(@`Д <Pd `p(Х0$ 0PX0P4pH`x0`PPp0h`Lxp, X  (`L0`P@ (P@L hPP L$%'8`//002x23p3333 4P40p4D4X4l44455 505@5 P5 5L5x@66077L7`7t0888:,p@xABBPC8CdDH8 IPPIdIxIINh@QR0T@TPVVW@P\\]  ^ ^\ a gT h Pk 0m m n PpL 0s t0uL@u`vx,|P}`}Ѐ 0@0PD`XplЁ  0l@ 0P`  4H\pЄ 0@P$`8pL`t 0(@<PP`dpx0@$@Pp`DPdАБPp0@dxPp4x@ И @К8`h@0@h@0DXp|`Ю  l   б  P P0!!!д!!0!з "x""`"h###`#`H$$$P$p % %4%H%\%p%0%P%p%%%%%&0$&P8&pL&`&t&&&&0&P&p&''('<'P'0d'Px'''''@(p (<(X(t((0(`(())4) P)@l)`)))))* 0*@L*`h******0+P,+pH+d++++ +@+` ,(,D,`,|, ,@,p,,- $-PP-t--`---.,. H.Pd.....0.` /(/D/`/ |/P////0@$0H0@t00 0@0`01 <1@X1pt1111 1P2282T2p202P2p2222 3 3043PH3p\3p333333 303@4P$4`84`44p44@44`545P5 d50x5@5`5p55D6p6`66 6 7L7@x7`788 t888p(9d99 9:<:ph::@::(;l; ;; <`<<X< << <P<0= |====$>8>0L>@`>|>p>>0 ? \? ? ?@ @ `@@p@A DA dA xA A !AP!A!A!A!A"B@"B",B"TB#|B@#B#B#B$C@$DC$pC@%Cp%C%Cp& D&8Dp'dD'D@(D(D(D ) E) E)4E0*HEp*\E*pE0+E+E,E,FP-LP>(L>@L>XL?L@LA MA MA4MpBhMBM`CMCMD N@EPNEhNPFNFN@GNGNGOGOpHDOHlOPIOIO@JOJPK0P L\PLPLPNQOQODQ P|QPQPQQ R4RRhRSRSR TST4SPUS VSV TV@T@W`TWTpXTX0UPY|UYU0ZVZ`V[V[V``(WadWbWbWbWpcWcX`dXd8XpedXeX@fXfHYgY`gYg,ZhXZ`iZiZkZ`k[k,[np[@n[ o[0o[p@\0pT\`ph\p\q\q\`up]u]u]w]x(^ y<^yh^z|^z^@z^P{^p|8_}h_ ~_`_`<`0l`P`p````8aabb@0bPtbbPb >`>> ?P?,?H`@AB B,B@CT ChpC|CDE0FFI,@I@pITIhJ KL`||}dPx @xP0p PD@@pйо`pH@ ` T0TPx@dp0\0(0*pUZ\0^^$_p``tPv`{@|,|LP`@P<| T@0 Pp<  x  D @  `  0 D X l  @  (``PHt 0 T0\ p@`0,`Hd@ p4< ` 4` t0D@h`!P$(L+/P0,`0@6:H<0==p?`@@A B`HpLM( OOQ0TTW@[,exPn0p0 u w !yT!y!z!|"}P"}" ~"~"Ќ#p$X$p$0& '()@P) )*h++p ,``,0,,- |-@-`-0-.@.p..0.\/p /#/&@0'0@.,111719D2<2=20>3>`3`?3I4JX4L4N5O`5Q5Sl6V6X7PY`7o8pd8@t8pu8p999` :`:@;;;<L<< X==P0>>>P????м?@P@d@x@п@ A AXAAPAAP@B\BB0BB$ChCCCC C D $D0tD0DEF8FTFF FF@G0\G@pGGGGPGGGGHHHI@IJ4JPJ|JJJ`4KTKPtKK0KK@KKL$L 8LlLLL0L@LL$MXM lMMMM M@N`N0NDNXNlNPNpNO(O $WP@XWPAWBWBXC\XFX GX`G YG YG4YGHY0H\YHpYHYHYHYJYJ(ZLZ@OZPT|[U[@WL\X\`X\pX\ Y]Y<]YP]Z|]@[]]]_P^`d^`x^0`^@`^P`^``^`^a_cL_d_d_id`Pi`i`i`ja0j(a@j$`CPDE8Gp`H̥pIOh0PPԦ QPQ`QpQ(RXR SSST8TL`Ul@VpVVШV@W4pWPXXYܩZ([\`[\`\ ]]Pp_``ܫ`j(0kdmmĬnoDt0w8xp{}0}(}<~ ЯP PDp`Ѓh`0Ph@̳0@0\pt ش`HppЕ@, ضЗ 0`Hp\p P`Էp4Pl0КP\X0ԺЭP`@0D@ppо0ؽ @0zRx $FJ w?:*3$"Dt\ #BHE E(D0A8G]HAB`Z 8A0A(B BBBD HIENHصfBEE E(D0D8D@o 8D0A(B BBBG H -BBB B(A0A8G 8A0A(B BBBH xlBBE E(A0D8GPsXH`eXAPXH`bXAPF 8A0A(B BBBH i 8F0A(B BBBH 0TIAKG N LEN DCALpBBE D(A0m (A BBBF M(D BBBLlBEB D(G0a (A BBBD N(A BBB4AKG N LEN H CAD HhAN ` AH 4BDA L ABJ NABHPFBB H(A0[ (C BBBI F(C BBB``FEE A(D0 (D BBBK Y (A EBBE  (D BBBA 0mEKG N LEJ eFA48HD\ 0p9EDG M CAG DGA0ZEDG M CAG eGAXFJN Q(A0I8D@HMPZXE`K@L 8C0A(B BBBH 4h @HdFBA A(G L"  (A ABBD `FEE E(D0D8DPq 8C0A(B BBBB W 8J0D(B BBBK |FH0x A T aFEE E(D0D8G@MHKPKXB`I@D8A0A(B BBB<dBID DPu  AABD gXI`^XAP(8 EJIP AAE DSFED D(G0M8K@KHBPI0D(A ABB4.FEE E(D0D8DPHXJ`KhBpIPv 8D0A(B BBBD iXH`JhBpIPnXL`MhBpIPNXJ`JhBpIP_XK`MhBpIPMXJ`HhBpIPhXM`LhBpIPwXK`JhBpIPhX_`BhBpMP|XH`KhBpQPXM`HhBpIPVXJ`JhBpIP@`FMH A(F0G`T 0A(A BBBK 8`FAD N ABD k ABB LFKH A(G0V (C ABBA o (C ABBI HPXFBE E(D0K8G@m 8C0A(B BBBG 8 d0L pFID D0k  AABJ < FJH G0|  AABA H8g@H8A00 HFJH D0F  AABJ < FJE G0E  AABK H8g@H8A004 FJH D0F  AABJ 0h CFJH D0F  AABJ H FBD A(G@ (A ABBJ HNP\HA@X tFKH A(G0L (C ABBK j (C ABBF g(C ABB0D FDA G0  AABD 8x dFJD D(D@n (A ABBH 8 FJD D(D@n (A ABBH 0 FID D0b  AABC 8$ XFBD C(G@| (A ABBH (` EFD0I AAF L `FJL F(G0T (C ABBK F (C ABBB @ FEA A(D0h8G@h8A0D(C ABBL \FBE A(A0D`hGphhA`V 0A(A BBBA p ,H X H  , FAD  ABB 8 l)FAA { ABJ T ABI , `sEAG I U AAA \<`FBA A(D0} (C ABBE w (C ABBI e (C ABBC X@FBB A(A08J@Y8F0A (A BBBH ~ (C BBBA  FFB E(D0C8N QL VRTAe 8A0A(B BBBD GHcBH[BFKBHdAkPKA HS ^ KL pBBE H(A0D8GcGBM 8A0A(B BBBF J\B`H$BBE E(D0A8G]GBAI. 8A0A(B BBBF lP FFB B(D0D8Ju 8A0A(B BBBG rH_BM\A(EHG`e AAA (HrEHG`V AAA 4tH{FDD X ABG GAB(EHG`q AAI ($EHG` AAA <gEAD Z CAH S CAI RCA4D(FAA _ CBD XFBX|]FBB E(G0D8Dpt 8A0A(B BBBD xN]xDp0 YEDG q DAJ DCA  MHM K h, HI D EG0_ AD 4ht [HD } AAJ @AAF8 EGG q(M0_CAD ZDO EQ4 EGD0_ AAG _8M@Y8A000\ [aGG T FAF HAA$d >EKG QJG$ AEKG QJJ$ CEAJ nCA$ FEAJ qCA$FEAJ qCA,@:AU J Y(L`GBDA uDBx:At*E`XdBBA A(D08O@W8A0D (F CBBE K (C ABBE 4 JBAH q ABA FABD]DX4BFA D(D` (A ABBK hQp[hA`D@ D PD@ I A` G ~ J `H G F 0(D>FHC iABp 6$@H[ E UHDFBA H(D0p (C ABBC D(F ABB0EKD  DAJ DAA8D@4Lp\FEA h ABA \AB \FBB B(D0A8M@p 8A0A(B BBBA D8N0H(G IBB\FBB B(D0A8M@p 8A0A(B BBBA D8N0H(G IBBXtlpBBE B(I0D8JL^Aa 8A0A(B BBBD DNkBMSKMEPH2Ee F A Ko F s E D(PHh H W<dXFHA DP  AABH VXM`\XAPcEb I rhLEF  4FHA k FBF QCBTHU8lFGA ] ABB F CBE xFEB B(D0A8D@[ 8F0A(B BBBF h 8C0A(B BBBD  8F0A(B BBBI $ 4En@ kT!YEOp\!FBB B(A0A8D7MMKI 8A0A(B BBBF IMNPBHQDI$FEB B(A0A8G 8A0A(B BBBG HTDN`SE@M]BLI\DMKaADM]EIELFKK^MFADY\hIAHFIXUAHKYUAHKYUAHKYUAHKYUAAK$`FBNKhBwMeUK_BRI^DWMkB]M^A|J_A_K^AK^DnK_BH]AK_BSKmBXK^AKmBXK^BsKmARIBMgBR MW ?5H] K DH?BBE E(D0A8Dp 8A0A(B BBBH 4 xA H tA\ pA&p A(FEF B(A0D8G` 8D0A(B BBBI h\pLxGBBI`hWpHxLGAS`hUpExGBB[`h\pRhB`WhNp\hA`ZhNp\hA` hUpExGBBI PhKpLhF`@T!HHFFB H(A0G 0A(A BBBK <!IFNO M(A0 (A BBBE !K!K"KFFB B(A0D8G~VMGTS[AQMaIU HbAaMQ }M`Bk 8A0A(B BBBA H"OFBE A(D0L (C ABBJ D(F CBBt"P*FBA A(G08M@\8C0D (A ABBG  (A ABBH t (C ABBD X 8P@P $t#QXYQM \CA$#QIEEG nDA#R!EW#,R!EW#@RBFBE B(A0I8JMIaFrLUEy 8A0A(B BBBE ~^PARFJA$X,HJJ O$X$X$(X4$4XEDH E CAF U CAG 4 %XEDH N CAE u CAG HX%YFBB E(A0Q (C BBBF F(C BBBH%YFBB E(A0Q (C BBBF F(C BBB%Y H&YFBB E(A0R (C BBBE F(C BBBHP&,ZFBB E(A0R (C BBBE F(C BBB&`Z6Ea J E&Z&HZ&Z &Z &Z 'Z $'Z8'ZL'Z`'|Zt'xZ'Z ,'ZQHD ABJ' [VD'l[FIB B(A0A8D@u8A0A(B BBB(([1EkD([JRXVId(\!x(4\ (0\H@ H 8(\yODG DAAHH FAAH(]FED A(M0V (A ABBG D(N HGI00)l]xEGD w AAG DRM0d)]EJG } AAK DRM$)^vE| G F B e)l^$)(_\Hq G D L K)`_*\_$*X_ l8*T_FBA A(D08N@\8A0Q (C ABBF z (C ABBF  (C ABBA *aPFBB D(K0G`0hNp\hB`Z 0A(A BBBB W hQpH U hQpJ ShAp[hA`X hQpO } hQpJ c hApJ U hQpJ U hQpJ U hQpJ U hQpJ U hQpJ U hQpJ U hQpJ U hQpJ U hQpJ UhMp^hA`U hPpG +hEG0E AF +iRE[ H iD+iVFKD _ ABI f ABG h ABE $,o!HX<<, oEND t CAA e CAG jCA|,o,o,o ,omFFI K(D0D`hMp\hA`Z 0A(A BBBD V hPpJ T hPpL RhAp\hB`c hPpL T hPpL T hPpL T hPpL P hPpJ \ hPpJ P hPpJ @ hPpJ T hPpJ T hPpJ T hPpJ T hPpJ ` hDpE ` hDpE F hApJ ] hGpE -0wRE[ H i -pwEG0A AB 8.xFFAA  ABD i ABD D<.0y&FKD  ABI f ABG L ABA <.~END t CAA e CAG jCA.~.~6Hm.~ /~BBA D(N08M@_8A0D (D ABBI a (G DBBH T8M@\8A0G (A ABBE T 8P@L T 8P@T T 8P@L T 8P@L D8P@,/TBDA  ABE 4/EDD  LKN p AAF 0LRE[ H i00BBB B(A0D8G[ 8A0A(B BBBG J`BGFIBMUAJLNHcLcBTOAd ME 009EDG M GAK DCA$1X FBB B(A0A8G} 8A0A(B BBBD H_TA]bLAHT\BADAAADDeGKIFN PQ HVCNX2,!AAG h AAE W(I0d(A f(H0^(A D AAH [(H0_(B \2FBB D(K0G@HTPHHC@^HNP\HA@Z 0A(A BBBD bHFPWHB@T HQPJ P HPPP @ HPPP b HFPH v HQPQ } HQPJ j HQPJ U HQPJ { HQPJ U HQPJ } HHPE b HEPE b HDPE f HEPE [ HLPE aHDP8X3yFBA A(D` (A ABBF \3XFKD  ABD f ABG M(M0^(C A ABI d ABI 3FBB D(K0v8N@\8A0C (A BBBD b8F@V8D0A (A BBBF d8Q@M8A0Z 8Q@J P 8P@P P 8P@P b 8F@H 4P4FNA  ALE i ABD d ABA dAB(4>BDA sABL 5BGA D(K0 (M HGIO d (A ABBF Xp5}BGB A(A0 (D BBBA t (A EBBB D8K@[8A057Aa N F45ЦAHG y CAC p CAD $$6CAAG wAA0L6rBLD D  AABG (6,>BDA sABD6@\BDA G  AABF RMTTK06XADG K CAE mCA8(7ĪBBD A(D0x (D ABBB pd7H1BBA A(G0b (C ABBI D (F CBBG j (C ABBF l (C ABBD P7BAA  ABK P ABE d ABA d ABI P,8BIB A(A0Gpd 0A(A BBBF LxCexApH8,BGB E(A0A8G@X 8C0A(B BBBC P8fBHD  ABF i ABD d ABA [ ABB 9An A v J HD9(BIA A(D0X (C ABBG D(F CBB(9lEAD y DAH X9`BEB B(A0A8Dpm 8A0A(B BBBA ZxH`xAp|:$FIB B(A0A8G@ 8F0A(B BBBB I 8C0A(B BBBK  8A0A(B BBBF :ĽBBA A(G L@LA}AMAYABA' (A ABBI !AMAMAQBNAZAOA[AFA1AMAMAQBNAcAUAFAFBFBFBFBFBFBFBFBFBFBFBWAQAIA^AAA4x;tAHG M DAN o CAE 0; QEHD h FAH DCAD;8"FBB A(A0D 0A(A BBBD H,< FFA A(D0R (D ABBC D(F ABBHx<TFFA A(D0P (C ABBF D(F CBBP<FBB B(D0A8D@WHDPhHI@G8D0A(B BBB=SEM4=H1Ek<P=lAAN _ CAE L CAH jCA=BEx$= EI B  K ,=FAF S ABE H>HuFMN B(A0I8D@ 8C0A(B BBBG ,P>|BFAA  CBF p> FEB E(D0F8KPXF`HhBpWP 8D0A(B BBBE # XM`ThBpE > ? ? 0? D? X? xl?\MIE E(D0D8JP[XG`OXAPP 8D0A(B BBBG `PPHXL`vXAP8?EO_ R HAJ D(M0cCA8$@EO_ R HAJ D(M0cCA8`@|EO_ R HAJ D(M0cCAT@BEB B(A0A8D@W 8C0A(B BBBD ZHOPMHA@\@HBBB E(D0A8D 8A0A(B BBBE |QjAXTABBB D(D0G@ 0A(A BBBB F 0A(A BBBB HA YBEE E(D0D8DP 8D0A(B BBBF LA ~BID A(G`hMpYhA`v (A ABBC N hMpM LBP `BLuH x H |BzBPE] F gBLzYp G gHBFBB B(A0H8G 8A0A(B BBBF CpE{ H gP6NE^ E 48P6EAD r AAB e CAG 4pP,7EAD r AAB e CAG 4P7fFED A(D0K(A ABB$P7:EDD jAA4Q7OFAA q FBG ACB@@Q7xFAA e ABH G DBK bCBLQ88FBB A(A0[ (C BBBH F (C BBBI HQ8FEE G(A0b (C BBBE F(C BBBH R8mFBA A(D0H (A ABBD F(A ABB4lR 9WFDD ] FBE YCBHRH9!FBB B(D0G8F` 8A0A(B BBBA HR,:FHE E(A0A8D`% 8A0A(B BBBC BHD lAB$T;gFBB B(A0A8Dp; 8A0A(B BBBI x\RxApwxS[xCpFxOODNpPx^DAADNpKxMRDNpT>*A\ C EDT>EDG t FAE D(C0i(F D AAD D(F0<4U?EAG m FAG T(C0h(A IAA0tUx?EAG j DAL |DAU?FEB E(D0C8G`hMpVhA`N 8C0A(B BBBD v 8A0A(B BBBH c 8F0A(B BBBF A hMpJ c 8C0A(B BBBI nhOpYhA`bhKpihD`vhOpfhD`FhOpOxAN`Ph^pDxAAAN`UhMpRxAQ`HV\CFOB J(D0A8G 8A0A(B BBBG 4V0DPFEA b HBH HABX4WHDREB D(A0u8D@T8A0E (A BBBH I(A BBBHWDBBD E(D0c (C ABBD D(C CBBWD+TV(WDAAG@v AAA ` XLE)BBE E(D0H8Dp 8A0A(B BBBD txN[xApf xNJ \XGFBA A(D0 (D ABBG w (D ABBH r(D ABBXhHPEJHYHFBB E(D0G8D`} 8A0A(B BBBA LYPK`YLK tYHK0YDKFDC G@P  AABH TYKFEE B(D0A8Dp\xLfxCpX 8A0A(B BBBB ZxNEe F B ^ 48ZOFFH G(D0a(A ABBpZlOE^ ] <Z,P.FAF D@  AABH LHCPgHA@8ZQFBA D(D` (A ABBD 0 [Q~FDA D@e  AABA @[Q"T[R08h[4RFEA C(D0 (A ABBA [R[RYEc H x[8SOBEE B(D0A8G` 8J0D(D BBBG D 8C0A(B BBBH D 8F0A(B BBBE @P\ TFBB A(A0D@q 0A(A BBBG H\hTFBE E(A0D8GP 8A0A(B BBBF 8\TFEI A(G@` (A ABBA 0]@UvFDI D0U  AABA HP]UFBE E(D0C8G` 8A0A(B BBBG 8] VFED A(F@g (A ABBA 8]tVpFEE D(D0P(A BBBL^VLFEE B(D0A8G 8A0A(B BBBA Hd^WFBE E(D0D8D@[ 8C0A(B BBBK ^W[H@M A ^@X_H@Q A ^XhHPZ A @_XBBA A(D0h8v@S8A0](A ABBHH_4YBEB G(D0x (C BBBK T(A EBEt_xY9BBB B(A0A8G L@LC 8A0A(B BBBA WCTCOCAC|CTCMCAC\ `@]BBI A(A0 (C BBBD A (F BBBC `(C BBBHl`]BBD D(D0Q (D ABBF w (G ABBE (`T^AID W DAF `^1Q[<a^<FEE A(A0 (A BBBF (@aa]QPU ZGAHla beFGD F(D0n (F ABBD D(C ABBxaDbFEE D(K0y (C BBBG y8T@O8C0A (A BBBA z8M@OHCPN0C8M@OHCPN0T4bcFBB A(A0G I s 0A(A BBBI D L ^ C 0bPdBFD G  AABF bebe4bemFKD G ABI AAB cf D4cffFDI G  AABI EH^A|c@gTcLgFBI A(D0GCNJYv 0A(A BBBA <chEDD X DAF N(v0F(A GAA((ddhnEID m DAD Tdhhdh|dh5PP H APdhBEE D(A0C (A BBBE 1 (A BBBH d\j?BAK (F0C8A@N b ABE M(O0W(K (O0W(F x ABG D(a0H8A@N w(F0C8A@U o(L0\(C A ABH LenBGA O`  AABC OTCb OJ `epopBBB B(A0A8G I j t!M A h 8A0A(B BBBH 4@f|qBAA G L!  AABJ xf4sBBB B(A0A8H Q DM 8A0A(B BBBB TMANcAvIMQS PJ $gy+BBB B(A0A8G L@LBaBTBOBAB 8A0A(B BBBA QBPBTBAB|BHBOBJBNB\g<}'FSI B(A0A8Gn 8A0A(B BBBK H^ATh BBB E(A0A8D@oHJP\HA@@8D0A(B BBBhh ,|h2NAA  ABG `hFGB A(A0* (A BBBF ` (C BBBG ` (C BBBG ilBBE E(D0D8G 8A0A(B BBBC SXKAWKfPoCAWKDqCUzHDipil 4ihFDD t ABK ZAB0jiEDD F FAF DCA`PjCFBB B(A0A8G L! 8A0A(B BBBG !f!H!A!\jBBD A(G0B (C ABBF  (C ABBC e (C ABBC k (k4Ek H Ahy=dN yuLb B zFy(^FEE B(D0A8Ik 8A0A(B BBBK XzHAHFFO`MZBHN[ArFPB B(D0I8G 8A0A(B BBBB $Af8DB^4LBFPF z ABG OAEChtC0D8FBB H(A0A8D` 8A0A(B BBBG DhNp[hA``FEI B(A0H8FPX 8A0A(B BBBI D8F0A(B BBB 0  ,48NHt9\ p  <ED G qF H(A0\C A pF H(A0xثTFDA V(c0R(B Y ABD K(a0M(F0q(A e(P0K(C A ABH e(H0H8C@N CABxTFBB A(A0G I } 0A(A BBBG @ I b A f P J D T N ^ B dЬ)BEB D(D0GPJXK`^XAP[ 0A(A BBBA RXI`aXAPGXM`\XBP48KFED a ABE KABp{FPD D(A0[8E@G8B0x8O@d8B08H@VHRPI0[ (A BBBE J8M@\8C0A (A BBBB c8H@g8A0 (C BBBG S8H@b8B0 8P@J @(E^(\vEID s DAF 4BBE E(D0C8GPOXL`iXFP 8A0D(B BBBI JXG`dXAPTXJ`]XJPDXF`IXGPWXI`hXFP]XM`\XAPK8A0A(B BBB44JDH l FBF mCB4lAEFP_ AAC aXR`HXCP84FBB A(A0G L@I@@N@e@E@Q@C@t@A@Z 0A(A BBBD @M@O@C@N@y @K@O@J@N@q@K@H@A@I ~@A@H@C@N@x@A@H@B@Y@h@Q@K@A@p;FIB B(A0D8JUBAIP\D 8A0A(B BBBD FFB E(D0D8IK^Da 8A0A(B BBBJ xNWCIs FN K_B?N\Eh]PBHı8 FBE E(A0A8G 8A0A(B BBBJ X TFBB B(D0D8Gpo 8A0A(B BBBD `xM^xApl4YVWH_ I f4sEAD N CAD a(g0H(A 4\&UAA DABBP XTFBB B(A0D8DPl 8D0A(B BBBB XK`YXAPt/Ei 8̳FJD A(D@ (A ABBH ($EIGp AAI 84FEE D(I0r (A BBBJ p,OBBB E(A0A8Dp 8A0A(B BBBE  xPHCHGVpmxHKFDGQpqdp L0|^ FBE B(D0A8J 8A0A(B BBBI WjFDIAPhIDDANISNBAKMHIANsNIDOfGUMKPLBDA\QWFKbSHCSWSLAbTkFGBAN]WDDANKSPBAK`}FHFDBANZAIDTh RLBDAE  QAAJ ULBAKnQdAKUiEBDARDRQIDAR&BBE E(D0D8DpxFEPACDDVpaxRIBMp` 8A0A(B BBBH axRIBMpcxK`xAp[xM^xApWxTIBMp@(5K` I\\(VFBB B(G0J8MHQPFHA@X 8D0A(B BBBI sHDPcHD@)FBB B(A0A8DPXM`LhJpSPyXN`OhJpNPz 8C0A(B BBBD TXH`^XAPUXM`dXAPXK`8D+FBA I(DPY (A ABBK (l.!EFD0 AAF p/*DexĹ/yFEE E(D0D8DPCXe`DhBpIXH`QhLpDxEIPd 8D0A(B BBBH XI`^XAPl@1FEE B(D0D8GPXe`EhFpPXJ`BhMpMxAaP 8D0A(B BBBE ,4*HGC D(B0B8B@BHBPIH4FED D(D0n (D ABBB e(D ABB,p5@EG qA8L5FED D(NPj (A ABBG @6LBEB D(D0D@ 0A(A BBBG \̻7zBBB B(A0D8D 8A0A(B BBBK mHAAZ,08BFGB B(A0D8G`hOp^hA`o 8A0A(B BBBK DhSpHxF\`phOp_hB`XhOpahA`{ hSpHxFJ I hWpH I hOpO I hOpO I hOpO X;BBA A(D0J (F CBBG j (C ABBF e(C ABB@<<8FBH E(D0A8DM^Ab 8A0A(B BBBJ 9HgBHM^A4ĽB^EKD P CAH  CAE ( DAND0I AAB l(DFEB E(A0A8G  8A0A(B BBBG G^AXM\AJ FEB B(A0A8DHBBBADABBX[ 8A0A(B BBBE DCgBCgAgHA HDTFBB B(A0A8D'R^AESBABAX@SBABAXJSBABAXJSBABAXJSBABAX 8A0A(B BBBA R`BFiBKFhATl\mFJB E(A0D8D` 8A0A(B BBBI DhMpchA`h_gFBE B(A0D8NSPMGABI 8A0A(B BBBA H0bFJE E(A0A8DP 8A0A(B BBBE X|deFBE E(G0A8GP5 8D0A(B BBBE XD`FXDPf f"ff0(f <f"EXXflf_FBB B(A0A8GOEDJHODDHBDALGGHANANGBBGNGAGGLm 8A0A(B BBBK ]EDGHQDDHBDALANBANBACBBABBAFGLnXEDGHNDDHBDALABBABBAABBABBAFGL0|lxDlBHE E(D0A8GPiXM`RXAPjXH`cXAPH 8D0A(B BBBD YXI`gXGPYXM`\XMP nFBB B(D0A8GUQIBI 8A0A(B BBBE LK^FHcAHcA(XtFDD p ABG (tDFDA uABu u `uFBE E(A0D8GP 8A0A(B BBBE  8C0A(B BBBA (<vMFDA ~AB(hvfEND _ DAE w wEZ A $pw&Af I  F e@xxAAG y FAG m CAG S(H0^(A 08Dy0ACG M AAF DFAl@yBBB B(A0A8GHX\KFHDn}HD^ 8A0A(B BBBG _KNDINNM\TOA$|BBB B(A0A8G L!!e"I!E!!d"W"F"X!|!K"\!A!{!F"a!B!!H"^!A!y!M"\!B!!E"M!A!~ 8A0A(B BBBA L!M"]!A!R!H"^!A!|HU((]FHH xHB4TFDA A FBD FCB40OFAH n ABH ACBHET(LfEND b DAB X FIH DPkXO`OhMpNPwXA`\XAP\  AABD IX``HXAPhԆ3US<FEE H(D0X (A BBBE <LFEE D(H0h (A BBBE /XRLFSI B(A0A8LG 8A0A(B BBBE 8lpFED D(D@| (A ABBA ԎEO@w AD 4@uFCF @ DBK QAB(Eb8 FJI A(D` (A ABBA \6dNt8D}EZ I P}EZ I PFBB B(A0A8G@lH]PKX^`K@D 8C0A(B BBBF HIPNXM`N@QH_PKX^`K@gHKP]HB@bHMP\HD@gHYPVHA@\ 8A0A(B BBBI LHLP\HB@fHNPOXK`I@W HOPM [HIPNXM`I@d<FBB A(H0u (C BBBG j8N@\8D0F (C BBBA L8N@\8A0LFBB E(A0A8J 8A0A(B BBBK <huFBA A(G I  (A ABBA ԘHfEDG0h 8O@I W8M@V8F0i AAE P8O@T8F0p0FEE A(D0l (C BBBF j8N@\8D0N (C BBBA b 8Q@M L8N@\8A0dpFBB A(A0GJ\D 0A(A BBBG DN[Ap FEE D(F0 (C BBBG ]8N@b8D0N (C BBBH c8N@\8A0Y 8Q@P \ |XqFBB B(D0A8G 8A0A(B BBBH wH^FIM\BUM\ADXBBB B(D0A8D@8A0A(B BBB(\AGG0 AAH 0AXK AK D[OA(0JuAHb N ]PACI y AAH p FAI [(K0[(A F AAF P(C0<DN F M$\0}Al C d D d<Al C I[ RCA F I[ TCA(\DT H IV WADT,BHK D0  AABH I8O@^8A0R8M@`8A0O8L@d8B0H BBB B(A0A8G L@LCUCZCLCHCKC 8A0A(B BBBG CNCPCECSC<CMC^CACC_CBCECKCC_CMCBC(@FDA qAB@FBB B(A0A8DP\ 8D0A(B BBBE XK`Sh\pZPXI`XhRpbPS XE`XhUpL \Xi`WXAPԳFBB B(A0A8G I!X 8A0A(B BBBH A!N!Y!A!!J!W!B!!Y!T!A! PQf I w Y $tQb E w Q wKTM G P|FEE E(D0A8Jp 8A0A(B BBBB }[OB[OAK\D<P \dFBA A(G I  (A ABBE k M b A I M ` A < EDJ  CAC l CAH mCAh gVpRJd<PFED D(F0b8{@DHAPI0` (F ABBA o8@DHBPI0](A ABB!HgFJB L(A0C8G 8A0A(B BBBG 08C] H q O x H e C g88FBB A(A0(C BBBth dHSl hF4QFDD N ABA Y ABD $3EDG `AA0<BAF Dpj  AABE p| x tOYT C TTK A D8dSl! ( <KEEX l$E^1TTM BBB B(A0A8G L)0)E)B)J*A*E*N) 8A0A(B BBBE z)J)M)B))S)Y)H))W)M)A)$zRx ), | x tK A H$BBE A(A08M@THPPL0Z (G BBBB `\E\ G k,FEB E(A0A8D@xHKP^HA@R 8F0A(B BBBE h 8C0A(B BBBD nHKPRXH`W@F 8A0A(B BBBF uHMPHXC`N@@HMPOXC`N@~HMPOXC`N@kHIPOXA`pTvFBD K(DP (A ABBI -XO`[XAPpXM`ThTpKPvXM`OhCpNP`XT`OXAP8QAM @ AAG A(M0M8Q@N EG AB (+<,P d x (dTL P(H0H8H@HHHPK,tEn AN  AH  04YET G xT{gXiN@tHEDQ Y AAK ^ FAK ^ FAK (AIG0f AAG \FBA A(D0f (F ABBA K (F ABBJ [(C ABBD8edY C `dBFBB B(A0C8GP` 8A0A(B BBBG XXK`KXHPAXG`GXDPwXN`\XDPQXM`\XAPF8A0A(B BBBLDFAA a CBB q ABD l(N0\(C AAB@HaEAG (M0^(A D CAE r CAB `FJA D(F0Q (A ABBF i8N@\8C0c8N@\8A0F(A ABB|FEB B(D0C8KJWA] 8A0A(B BBBF O\EMbAEbHAID{FBB D(A0J 0A(A BBBG p0sFBB B(A0D8G`hLpYhA`hFpIhB`ihNpYhA`x 8A0A(B BBBJ H@<FBB B(A0A8Gp( 8A0A(B BBBI (tEDN O AAH HdFBB E(A0A8GP 8D0A(B BBBJ 0FAC G0s  AABH 8FEB E(D0A8G 8D0A(B BBBH JPIILIUJK9PZFX FEE G(D0D8DP 8C0A(B BBBG SXH`^XAPH EAG@K CAD BHBPDXD`I@CADl:BBB D(D0G 0A(A BBBG HBJD D(G (A ABBE LM^A(lAHDPG AAJ 0,UBFD G  AABG 0`QHJ Z CAG uFAX^ rEK@[ AA dI FBB B(A0C8G`, 8A0A(B BBBC lhMp^hA`_hMp^hA`@4!)EAG j CAE e CAG h CAD Px"sFED C(G0u (F ABBG U (F ABBH %^`L%^FBB B(A0K8DNJANY 8A0A(B BBBI LDH(FBB B(A0A8J  8A0A(B BBBI ,j@-FBB B(A0A8G L. 8A0A(B BBBE .F.I.A..J.G.G.I.o.O.^.B..P.T.A. .^.G  .H.E o.I.\l@BZBA D(D0| (H DGKQ Xh0D(A ABBXCPBA A(D0J (D DBBB t (D ABBC W(A AEB0(CyQAD J FAI DCA@\CFAA g ABF b CBA ACBHFEE D(D0L (C BBBC Y(n RMBt>FPB A(D0GXS`WXEP^XC`lXAP[ 0A(A BBBD XM`aXAP\ XP`I DXC`iXBPZ XU`O W XG`R |BvFEE B(D0A8J\OD 8A0A(B BBBE lGbFuGHBBBABBBNZVAa ZE DGFBB B(A0A8GpxQBBBBABBBSp 8A0A(B BBBD DxN\xDp^xeHxApE xYE XKFBE E(D0A8GPSB{ 8A0A(B BBBI VJKIAIMGGMLEBBBABBB\[FHOF 8A0A(B BBBK $YRAPRnFBB B(A0A8G I! 8A0A(B BBBF !J!\!B!!K!c!A!!R!O!A!P!B!A!A!Z!W!V!T!A!O!J!N!B!Z !B!A!A!E , lXEC DGH E P\\ BEE B(A0A8G6HVBQ 8A0A(B BBBH BNXBMSAYZSA SE c FLJ E(A0D8Jq[BxTHDBBIUFAW 8A0A(B BBBD IHBBBBJBEQkGQAmBEB B(A0A8G`hOpGxAK`hXpOxNI`V 8D0A(B BBBH ghJpbhA`AhKpDxBM`DxpFBB B(A0A8G L#a 8A0A(B BBBD #M#\#A#~#H#H#C##M#]#B# #F#_#D#4#F#T#A#(_ECDPK AAA  _Ee F n<`kdc U`X&BBE B(A0D8JFYBi 8A0A(B BBBI nHA{ADDPR`AHkAM^BFUADDDI/ZMBFjAT PP _ TJ 4 DE MJANK]A[TIELpFBD A(G0 (D ABBA h (D ABBG p jBBA D(G0t8Q@SHHPN0[ (A ABBA S8Z@_8A0w8Q@SHHPK0H(A ABBHܶTBD A(D0iH0d(F ABB| Pt=FBE E(A0A8DQMiBXQVDToLTGTOgBHPfAPgBi 8A0A(B BBBC P PP gAADT\ IJ KQRCTTWFPTWFBbWFPTmWFPTqWFBbBWFPTQMiAlWFPTgWFBbgWFPT WFBB lWFBbN WFBE YWFPTH WFBE dWFBbGWFPTOWFBbgWFPTgWFPTg WFBE YWFPTgWFPTyZaAcZaAohFAVHhTBzWFPTWFBbWFPT|WFPN^ WFBE VZbBpWFPTgWFPTk WFBE YWFPTMKFCJbC_B^ CE GFSAiOWCYc TDAAFJ iWFPTgWFPTp WFBE YWFPTCWFPTjWFPTnWFBbgWFPTg WFBE YWFPTgWFPTkWFPTv WFBE Y WFBE YWFPT\PfAcZ\AfWFMVhQKBbZaAhFAVWFMV\_AmMSB \E LFSAWFBbnFTBl QKBE VXaAHHAA\R HAAE v HAAE mMHAV{HAAb{ HAAF YWFPTgWFPTE_ZA{WFMVDHAVwX[AyFHAVBFHAVCHFAV~MHAVdXaAqfTBGXbBzHFAVtfTBPHFAVd_ZAdXaAo WFBE YWFBbdaYBbWFPTg WFBE YWFPTgWFPTgWFPTL AABE YWFBbg WFBB Y WFBE YWFPT$LjBdSFRTpWFPTL%P/FBE E(A0A8DPwXO`GhGpDxGDDIAIPXZ`OhBpBxDWPu 8C0A(B BBBA  XU`FhBpBxDG ^XN`KXAPLXD`hXAP&@&MHD } ADE TABIP H\&0BBB E(D0D8DPS 8D0A(B BBBI 8&FID A(D@ (A ABBA 0&XBDA D@u  AABD \'PFGB H(D0H8DPVXG`mXAPXL`aXAP]8D0A(B BBB`x'4BEH B(D0C8D@vHLPmHA@P 8D0A(B BBBG _HLPuHA@\'\BEH E(A0A8Db 8A0A(B BBBJ vPKA(<(nAID m DAH h(|(bES H H(4iBBB E(D0D8DP 8D0A(B BBBK 4(XBGF E ABI dAB0)|AFM o CAI eEAP)aHX\h)TFAA (H0b(A A ABJ t(P0[(B L(R0K(L (P0Q(B ()E@H bAA G L)hFGD O(M0a(H Q ABF s ABJ nABlD*FBD D(N0K (H ABBJ j (C ABBF h (C ABBH e(C ABBl*tFBB E(D0A8D@HNPgHA@Q 8A0A(B BBBA t 8C0A(B BBBH D$+FED D(D@Q (A ABBB LHXPHHA@8l+pFBH A(D@f (A ABBG d+#FAA U CBF T ABA K(C0g(C A ABD G (Z0G G(_0O(A \,(FAA M CBF T ABI p ABE D(F0h(A I(F0h(A (p,l8FDA iAB4,lEIN0x CAH  CAG D,FDA S CBE K ABJ f ABG -C00-QEHD h FAH DCATd-FED H(G0X (F DBBD u8M@\8A0F(A ABB-FBA A(G@^HHP^HA@D (D ABBE WHMP\HA@G (A ABBJ  (F ABBF n (D ABBI 4H.ZFDH y ABB CDB.E.YES.*.0>4.\JFAH m ABA FAB4/trFIG J ABE FABP/d/8 HRH|/@ FEJ Q(H0K (D BBBE H(D IBB(/ fFDD d ABK / >0 90@  00L EG G AD T0 4h0 FDA G CBI dAB0L FEB B(D0A8G`h[pFhA`D 8D0A(B BBBG ]hYpThB`m hPpO DhFpMxVN`IhFpmhA`m hZpL K hPpJ @1L}EK H d4`1iEDG0g8f@O8A0X AAI (1FHD AB(1>FHC iAB@1EDD j CAE W CAE D(T0Y(A 42X*TH2tFBB B(A0A8DP} 8A0A(B BBBG XI`^XAPH2<BBB B(D0A8DPy 8D0A(B BBBI H2FBB E(D0D8DPz 8D0A(B BBBF @83DEAG | CAC V CAF u CAG `|3 FBB B(D0A8D@zHIPzHA@ 8D0A(B BBBE THNP_HA@3 d3FBD A(N0C (F CBBE u (C ABBC L8N@\8A0F(A ABB\4Pp4\G\j4I84FAD ] ABE  ABF 4tHN44|gDJ Y CAF DFAE8(5FJK A(D0M (D ABBJ (d5ANAD iAAB$5=EDN _AA5FLE B(A0K8LkLGFCkA[ 8A0A(B BBBG O[A OU | FV OTII} VJ h6FSB B(A0K8GNaEpMYBl 8A0A(B BBBJ M\AaN[Dd6p!FBB B(A0A8Gpy 8D0A(B BBBE UxKmxAp!xM\xAp0d7$FAD GP  AABA h7T%?BEH A(D0h (A BBBE  (A BBBK e8F@h8C0A(A BBB8(&H8$&FBI D(A0 (D BBBG T(A EBBDd8&FEA D(GP (A ABBC dXF`jXAP88 (ZFBI A(A0(A BBBL8D(FBE B(A0A8G2 8A0A(B BBBD 89)LL9)FBB E(D0A8D' 8A0A(B BBBG <9P,PBA A(D0(A ABBH09,iFKD D@  AABI : /En M b F H4:x/FEB B(A0A8D@B 8C0A(B BBBE ,:/FDI h ABB :03:0#:0 @:0FBB A(A0GPl 0A(A BBBI \0;3FEE D(D0k (C BBBD b (C BBBE T(C BBB\;3FBB B(A0A8DP 8C0A(B BBBF D8F0A(B BBBD;L4FBA C(G0P8O@k8A0D (A ABBH d8<4BEB B(D0A8IP\ 8C0A(B BBBG OXJ`QhRpTPXH`lXAP(<6JFAD {ABx<6FBA C(G0G8M@Y8D0d (A ABBB K (C ABBE k (C ABBE [8J@c8A0LH=T8)FBE I(A0 (D BBBF e (C BBBA ,=49sJa E LM \DAF=9s=93TNL=:XFEB B(A0F8GCoAkMdCVJdBPM_BwRcALeB`OBf 8A0A(B BBBJ fHFIHP_EOGnAcOAD^OAPXEEKT^B/CIBN\C JV F]AwMcA_ LQ D KV @JWRIv LX t LQ ER[AMcBi FE AO`Hf TJ DGnAGoB FE D@(PFBB B(A0A8JD]B 8A0A(B BBBH NTHPIeATHAFmET@,^'FBB G(A0A8DP 8D0A(B BBBA LXk`HXAPHA_FIB E(D0D8DPXI`^XAPt 8C0A(B BBBG XXI`^XAPx 8F0A(B BBBA p8F0A(B BBBAd`3WUlA`{FBB I(A0A8DHpHhHgAv 8A0A(B BBBF `BcTFBB B(D0A8DGRMOSLA] 8A0A(B BBBC LHMIW[ HMIF L HMIE  CPeFEB B(A0A8GEFAnPaBKLCKuRLDDHjEKaAIsASKcA 8A0A(B BBBI MVAKLCKCGBXMYALMVAPaB0N[BMN[AU MO 0I_B^ JN QXXBaM\BlQ^AN\AQN\B9FfA,YYA{ IJ ENH(`0K(A T A LDEFBL A(A0 (A BBBG `(C BBBE(EAC DFJ H hEBBB A(A0G I x H ^ D  0A(A BBBK H e H A ,@FLAC DGKv H DpF FBB B(A0A8DP8D0A(B BBB(FĊAJF0H AAE $F8mAm B L L dH GBBE E(A0H8NP 8D0A(B BBBI \XG$BBH E(D0D8GpE 8D0A(B BBBF ExDDDIp@Gd;BEJ K(D0Gz 0A(A BBBG 0G`AC BEEEDs D 0H̔& DHKKW F UK hHEN f AF LHFBA A(D0O (C ABBK V (C ABBB 4H`EDD _ DAG [(M0\(A 0IIFJ e CAF mCA`HIt~BEJ E(D0A8D`hJpKxDABN`m 8C0A(B BBBG IH0 G m(IPsEAD } DAD \IMBEB B(A0D8GdHcD 8A0A(B BBBG dXJ]FBB B(A0H8DP 8D0A(B BBBA \XM`\XAPsXN`OhMpIP JbTZdJ(cJ'HQ G F<KFBB H(A0x (D BBBK 8XK4FJA D(D0 (D ABBA HKإFBI B(A0A8D@ 8D0A(B BBBD Kl$Kx8EGG XGApL BBE B(A0A8DHPKI| 8A0A(B BBBA H`GdL̯FEB E(A0F8FpBxKSxAp 8A0A(B BBBF Lx[WxDp8LDFLD C(G@Z (A ABBH x4MQFID A(D0z8E@V8A0\ (H ABBI s (C ABBE v (C ABBB h(C ABB`M̳FBE G(A0D8GP~XJ`JhBpAxEIP[ 8D0A(B BBBE NHnFEE B(K0C8Gpa 8A0A(B BBBF xLOHABIpWxKTxApxI^xHpcxITxApN(FGE E(A0D8LPpXM`IhGpAxDQPXXJ`QXAPY 8A0A(B BBBF dXD`UXBPKXJ`QXAPX 8C0A(B BBBF m 8C0A(B BBBG c 8C0A(B BBBI tOXFBH B(D0A8D`\ 8I0D(B BBBL  8C0A(B BBBD  8D0A(B BBBL a 8A0A(B BBBE L PPCFEE D(A0G@QHNPNHA@Z 0A(A BBBD \PPFDB B(A0A8DPi 8J0A(B BBBH h 8C0A(B BBBD T 8F0A(B BBBM tXL`^XAPPxjP akm0QxEDD B GAI pCA4HQFAD M CBC rLB@Q\FAA x ABE q ABD dABTQVFBE E(A0A8D@ 8C0A(B BBBF PHdPMHA@XR FBB B(A0D8DP9 8A0A(B BBBH XM`\XAPLxRd<FAA q ABD _(M0^(D A ABA p (A0B RT%RpNBB B(D0C8DPXN`KhMpIPI 8A0A(B BBBD m 8F0A(B BBBD s8F0A(B BBBFHP`XK`^XDPSFBB B(A0A8JNQA_KPA 8A0A(B BBBC =DBBI<TFBK D(G  (A ABBH PTFAA mFBxg`g gSgH,Dgg`:Ah G I\g:BEB D(D0| (F BBBG b (C BBBE `(C BBB$Lh`gaMV [FA0thAX G IK ^CA J IK $hAu J G I G4hl ADF  FAA e CAA @i!BBB D(C0F@ 0A(A BBBJ @Li!wRAD P FBA U(L0^(C AAB@i"BBB D(A0IP 0A(A BBBH 8i#xBED D(G0T (C ABBF `j $BBE E(A0C8DS 8A0A(B BBBE FGBI@tjX*;BBE A(A0G@' 0A(A BBBG `jT,BBA D(G0_8L@SHFPK0I (A ABBB V8I@`8A0I(A ABBXk,}FBB B(A0A8D@ 8F0A(B BBBA _HFPHHA@xk.4k/zBDA U ABA VABk/ BBE B(A0C8GOWBTHD^ 8A0A(B BBBI fK~A`LAPM]BM\Hxl:BEE D(A0e (A BBBC c (A BBBF d (A BBBE W (A BBBB d (A BBBA O8M@\8A0` m ;xBED D(D0j (C ABBK k 8P@M U8M@\8A0F (A ABBE Hpm<<BED G(G0s (F CBBG C(C ABBDm<BHB E(D0D8FP8D0A(B BBBhn(=)BBE I(A0A8GpxNLMNp` 8A0A(B BBBD AxM\xApHpn>FAD (M0\(D J CBJ ` CBK W(P0n?,@n?GAA p(L0^(D J CBJ `CBo(@(o4@yUY4@o@BDD z ABI JAB,xoAlAC FM2 G oDU8oPU9BED D(GP (A ABBH oTVKD] G DpVBBB B(A0A8D@8C0A(B BBBl\pVBDB B(H0H8D` 8A0A(B BBBJ xhIpghA`v 8F0A(B BBBB HpY^BBB B(A0D8Dp 8A0A(B BBBK xq] BBE B(D0D8G`hNpVhA` 8D0A(B BBBE |hMp\hB`hMp\hA`^ hPpL 4q(a<FBD D(G0N(M ABBLq0aBBE B(A0D8D 8A0A(B BBBC rd0r dDrdXr$dlr0drFHC iAB(<4>FHC iAB<,P4lEAD N CAD P(F0i(A IAA0l4EDG } FAD KCA$42EDD `CA4ȕ5YFAA z ABK CCB<5 854(D5jFDH J ABA CDB`|5EHQ k|5!L5_ERD | AAG G CAE h CAD c(M0\(C H6WFBB B(A0D8F` 8D0A(B BBBI @,<ECG n AAA l(M0\(C w CAE @p=ECG j AAE ](R0Y(C t CAE x>Wlj̗>paa F g(?sEKG k AAD 4d?EID  DAG Z DAA P,@FEH B(A0D8GP^ 8D0A(B BBBD LXH`bXDPiX^`SXBP^XF`iXBPXE`IXAPXXP`^XAP\ XM`L DXI`C'C$C',D%@DEP\ DFJI B(D0A8L^SBOU[A_[Bg 8A0A(B BBBA mbWBoFNAHKMHPS PJ l@HFEA D(QP (A ABBG u XP`K TXM`\XAPN XP`L TXM`_XAPc XP`G 4`JiEMG i GHO { CAA ,ĚKyFOM  HRP @LFDD E ABJ g ABF dAB@8dMYFBB A(D0GL 0A(A BBBF (|NVAID [ DAB HNFBB E(A0D8G` 8A0A(B BBBD dOzFEE E(A0A8G` 8M0D(B BBBG  8D0A(B BBBE 0\SjENI M CAC uCA(SEND r DAB pT8ԜTnBBB A(A0^(A BBB,U8FAA G L@I@@K@`@B@`  AABG Q@M@Y@A@@H@]@K@I@K@M@Y@A@N@L@K@C@P@\WFBB A(A0G L@I@ 0A(A BBBF P@M@T@B@Y@T @M@T@H@G @ @H@O@I@H Z@M@R@Q@I@^@M@T@O@I@@H@H@H@W@P@I@O@O@W@M @H@H@H@E H@K@P@H@W@j @F@H@A@E f @D@H@A@J [ @H@H@A@E Y @F@H@H@E Y@F@H@H@@D\EG W AD P(M0T8T@K X(M0T8P@I L ]FOG B(D0D8GMTA{IOJNr 8A0A(B BBBF xO^Dgxԟ(_FDA Jw  AABH DL^AgPKAsHOJNyMOCNP`XKG A l`vEIt AE l,a4EAD  DAK e(I0O8A@\ G AAE f(M0O8C@N a MOP e (F0O8A@M bFHE D(D0D`h_pHhF`H 0A(A BBBD JhMpOxCN`GhMpTxCP`khMpTxDI`HXeKEL\Pt AAE PXM`ThPpIPXXH`ThRpIP,С\fED G fM O(C0NFf LfuAN_U AAK tTOA_TOAxdhBBB B(H0A8DPXT`MXAPbXR`OXAPL 8C0A(B BBBH D8F0A(B BBB\iaBLB E(I0C8QlGPBTOA 8A0A(B BBBK cTOAtMOCNsMOCP,$lKAC DEED H Dm ̣@mFEF B(A0D8DPE 8D0A(B BBBB XJ`QXAP[ 8F0A(B BBBE XK`HXFPXc`IXBPXo+E_to o oIKQ D hp Ф p p p  p  o 4o Ho \o poo o oo HԥoEGF m MHL Q OJF D AAJ IPC p 4p\Hq \q pp\Hq DqPq LqԦXq Tq Pq Lq $Hq 8Dq L@q `\XDFEB B(A0A8D@Y 8F0A(B BBBC p8C0A(B BBB TDHV B j F Ix4EG,pEEID e DAD EE EERE[ H i$FNE] F _ 8TFEZ A H\FBEE E(D0C8DP 8D0A(B BBBD |IBEB E(D0F8D[LEKSKTAH 8A0A(B BBBH  GQ p($QBEH B(D0D8NBBBI^RUB| 8A0A(B BBBI (`VAADO AAI HTW9BJD D(D0m (F ABBH (C ABBHXFBB B(A0D8GuMOCN 8A0A(B BBBI KPYAjIOA\X MTCNwKHAE C_IBACNlM\A[_IBACN(<_DP]XD`GhApLPh G $<_\p D QN YJd(`RBLE B(G0A8G_bBN\HBB]T 8A0A(B BBBH tIBB]bBEE E(D0D8DpTxPBBIpC 8A0A(B BBBE MxHBGNpxxZBGNpp\c?A] B P|c]Al K dHcBEE E(D0D8FPa 8C0A(B BBBD `dNBBB E(D0D8NMJFL| 8A0A(B BBBC IeDbMA,,gACE K(A0NA D r8gBHD G(D0B (D ABBD 40hFDD z AFQ C ABJ $hFJB B(A0A8JSDDAND 8A0A(B BBBH |BKYNBKYI~IEaMcAL^AvBKYIirTBGKHQ rE  FGEYPM ]P]BNMMI SM % SJ  PJ Y PJ  SJ J PJ IMQHIL{FHM N(A0M(F n(L0`(A K ABJ vABXp|FKJ A(D0B8B@BHAPK0D (C ABBB g(C ABBXx|.FEE E(A0D8GPGXM`JhDpMPV 8C0A(B BBBF t}xFBB B(A0A8JAGMBN 8A0A(B BBBC ZHLBNXLFBB A(D0e8M@PHGPI0Y (A BBBG d(A BBB8DBGD } FBF b CBA T؀"BBB B(D0D8JrN`A 8A0A(B BBBG N\AHBBSPUATDE`DNBE[QBEVyP\AP]BBBBNpHIBSIJFVCN]B QJ <0BBB B(A0A8G L" 8A0A(B BBBE e"G"B"A"S"I"T"O"A""]"J"G"I""c"K"A""I"O"J"N"J"b"T"E"<-BBB E(D0A8JcLMGI} 8A0A(B BBBC GEDIN`DRHXJNLVZBy WB L BBB E(D0D8G 8A0A(B BBBH \ 1 BBH E(D0A8JhiVB 8A0A(B BBBE `h dFBE B(A0A8JRHLBI' 8A0A(B BBBC < FJE K(A0J (A BBBF  @  < |4 8\FEE A(D0a8K@OHBPI0R (A BBBD ~ (A BBBC d (A BBBE d(A BBBX [FEB B(A0G8G`whGpwxDV`O 8C0A(B BBBH p FBE E(G0D8DkHLBIz 8A0A(B BBBA zMbA` hfFGD f(K0K8B@I C ABB  ABA T ABI f ABG P tFDG l(K0K8B@I  ABH t ABA t ABI p< FBE H(D0D8DLHLBIz 8A0A(B BBBH MbAp \FBE E(I0D8FdGLBIz 8A0A(B BBBE zMbA$ yFBE E(I0D8FdGLBIz 8A0A(B BBBE zMbAHiAp FEH D(A0GHLBIz 0A(A BBBA M`AS MO pFBE E(D0I8F|ABBIz 8A0A(B BBBE cMbAp"FFG D(GYHLBI} (A ABBG +R^AM^A@HjFCA G`yhHpLxBI`  AABD Ht FBB B(A0A8GMJFSfJTB 8A0A(B BBBE bMAXFJD D(D0f (H ABBA g (C ABBA e(C ABB4(bFDD _ ABH fAB `ERP@ AH WG^ K fDFBD D(D` (A ABBG shNp\hA`p h AZ( l1BGA cABTLgAI]p AAG bHTQNMMQN:TO E N#BBB E(D0D8JYLeAV 8A0A(B BBBH HTQNHRPBqROAfMMQNMTBU MB X BJN K(L0w (M ABBF h (C ABBH h(C ABB`PBBB D(D0` (A BBBK  (C BBBH 8M@MHQPQ0\LBEE B(D0D8FHSPAX 8A0A(B BBBF >Hl IAHo IH+HH Z\FEE E(A0D8D@nHKPNHA@D 8A0A(B BBBD DHPPMHB@LHhPFHA@I8A0D(B BBBDFAA J ABK j(X0F(D \ ABE  | xt4yAOG  EDM (M0\(A TaBEE L(D0D8DuKMOHFDDIvKKDIULKDITDDFFFNMDDDIDDDDIc 8A0A(B BBBK tODDI@LNDIN_Al  0mH`P H \h_pDxDDAY`T:TF F(F0SttmFAA B(G0o(D K DBK j(M0Y(D q CBF D(M0Y(E N ABH (M0Y(D `lFBB B(A0A8DeC\DPIMDImKKDIdDDFFFNWDDDIDGDDAKKDIp 8A0A(B BBBG ZNeATBBE A(D0GQDDIZDDFFFMDDDD\h 0A(A BBBA DODDIrHDDIBBB B(A0A8G L"B"z"C"B"]""O"P"D""N"\"D"[ 8A0A(B BBBG a"N"\"B"0 _ADI P CAF rCAT 9BBB B(A0A8D@| 8C0A(B BBBJ IHKP`HA@p, BBA A(DpF (A ABBJ rxGODAHIprxDDDIpQxT`xApp6BBA A(DpD (A ABBD rxGODAHIpexT^xApDxDDDIp5BEB D(D0DplxNHHNp_xDDDIpZ 0A(A BBBE wxTYxAp xSQ d xSQ @lfBDD T ABG J(]0O(C AAB@BDD u ABF J(]0O(C AAB@(fBDD T ABG J(]0O(C AAB(lKDDD tHB4BFB B(A0H8D@HMPfHA@L 8A0A(B BBBD j 8A0A(B BBBL m 8I0A(B BBBE h \BBE B(A0A8DmLIAHHKANAMAIAHAAw[WKFDAINDDDIf 8A0A(B BBBD _gAHHMAIAHAAqSMhADDDDIrDDAWT XOIAHAAn[RDAE BBB B(A0A8G 8A0A(B BBBE CNBmAMROIAHNDDDIS[ATTXBNFHX l | xHt D 8(H`N J zhIpDxDDAY`U J  JdF F(F0S\  5FBA A(Dh (A ABBD cI[AjDDDILp !FDD p ABG J ABK H DBJ eCB$ \"mEo L A G O, "FFE H(D0D8LxbHBYCNHFHIAIAAAMPjDDDI` 8A0A(B BBBE MHNHMHIABAIHNNENAK[Av PL T PL D PL d"'FGD I`lhHpYhA`BhHp`hB`WhDpDxDI`Z  AABB PhMpbhA`8")@EAD`~ AAF |hDpDxDI``"*(FBB B(D0A8D`W 8A0A(B BBBJ hJpNxBABI`d #|.>FBB B(A0A8D`?hHpHxIABI` 8A0A(B BBBE #T4FBE H(G0D8G`hMp^hG`UhMpYhA`BhDpJxNABI`r 8A0A(B BBBC KhMp_hA`hMp]hB`JhIpchA`I hNpI P8$9FAD I`UhNpHxHI`_hDpDxDI`V  AABB $`: FBB B(A0A8GMeBsDMPHIAKAIADAHSGGGIQ 8A0A(B BBBE RTBPTBp0hPBxDDDDDNT SR iMGGIEGIDDDNLO`AB^AQN`AYS_AU LS IIuAISZBI LS ^ LS U NQ \&CFEE D(D08B@N8A0C (A BBBF X (A BBBI X8j@I8D0A (A BBBI } 8S c8[@W8B0 8W X 8[@M H8f@H8A0] 8[@E `'FFBB B(A0A8G I! 8A0A(B BBBA !c!O!A!t'HIFIB H(A0L8L~ 8A0A(B BBBF ^YJIAIAKAHS`DDDMNdAI NP (KFEE D(D0 (A BBBF i (A BBBH L8E@l8A0A 8J@U v 8J@X Z8E@l8B0I 8J@U D8J@(OFBE E(D0D8GBMTHIAIADAHIUDDDI] 8A0A(B BBBJ D)PSFBB B(G0D8FGODAIIfDDDI 8A0A(B BBBG TDDDI8)dREAF`hDpDxDI`[ AAJ $*(TUAJHC\<*TBBB I(A0A8D@k 8C0A(B BBBD HHTP[HA@PHTPl*PU[FBE D(D0DpxKCIAIIp[xDDDIpa 0A(A BBBF +@XFBB G(D0DpxBMPHCIpexDDDNp 0A(A BBBI txDDDNpP+\ZEAD`ghHpFxOHHK`_hDpDxDI`g AAJ +[ +[  ,[ ,[EP<,['P,[*d,[%x,[#,\#\,,\FBB E(D0A8GH[Ag 8A0A(B BBBG 8-^FBA D(Q@ (A ABBG P<- `FIH A(G08[@8D08T@S8D0(H DGKl-cFEA D(G0 (G DBBK e (D ABBB e (D ABBB h(D ABB.d.dRE[ H ix4.8eFBD D(DPc (A ABBC X[`WXBPXO`VXAP^X[`[XAPeXT`OXBPYX_`ChFpKP0.hBDD G0y  AABB L.8ilFBB D(K0 (A BBBA n (A BBBC D4/XnFAA c ABB d ABI i ABD D|/oFKD  ABI f ABG $ ABI |/uFJJ A(A08C@l8D0K (A BBBE p (D BBBF j (D BBBD b(D BBBD0wHX0wBEE E(A0D8I@C 8A0F(B BBBG @0HwBJB A(A0G 0A(A BBBE @0wBJB A(A0D 0A(A BBBA ,1`x\@1,y&BEE E(G0D8F@ 8A0A(B BBBA D8O0A(B BBB1yM_mH14zBEE H(F0w (A BBBH h(G BBB@2zBGE A(A0G 0A(A BBBF LH24{_BGB B(D0A8G 8A0A(B BBBD 2D|D2|UBJE A(H0J# 0A(A BBBA X2}BGB B(A0A8DRaCX 8A0A(B BBBE <P3BJE D(G0 (A BBBF L3BBB B(I0A8G= 8A0A(B BBBH 83BFA D(G` (A ABBF \4BBB B(A0A8DpOxPJFSpT 8A0A(B BBBA L|4pBHA D(Jw (D ABBG ^ (A ABBD H4 BBB B(A0A8Dp/ 8A0A(B BBBI \5FBH B(D0F8D@s 8C0A(B BBBA H8A0A(B BBB`x5FBB B(D0A8D@g 8C0A(B BBBH t 8D0A(B BBBA 5$AZ E CH5 FBB B(A0A8D8A0A(B BBBH6\6`nFBB B(A0A8G L2 8A0A(B BBBB 2`2J2A22P2M2C2S22\2T2K2Y22P2M2C2S27,\7xH(7: FEB B(A0A8G`/ 8F0A(B BBBJ Ht7xFIB B(A0A8DP 8H0A(B BBBK d7SDB B(A0A8D`I 8A0A(B BBBA 8H0A(B BBB (8$E E XL8BBA A(D0u (G CBBK e (D ABBJ D(G DBB48BDD e ABF YCBL8 FGJ B(A0A8G 8A0A(B BBBJ 09 D9 \9HNLt9ADG V(O0[(A Z FAB L(I0`(A F AAB 898,FGD I(D0k (C ABBG :,EM:00:,D:(4X:$EFAG J  AABK D:EIG r AAG @@>EMG o CAD c HAD c HAD l>(FKE B(A0A8Gpx`LNTp0 8A0A(B BBBB YxM\xApd>HFKB E(A0A8D`' 8A0A(B BBBA  8F0A(B BBBF 8\?FDH W(U0_8B@I A ABD ?/HM N(B0I?$/HM N(B0I8?4FDH W(V0X8B@I A ABJ \@FGI A(G0[8M@NHKPI0K (C ABBE E (J ABBL Tt@FNM D(D8A@HHBPI0K (C ABBH v(G DBB|@pqFBA A(D0s8c@HHBPI0K (C ABBF { (J ABBF J (C ABBF e(J ABBhLAp)FEI A(G0T8V@UHBPI0K (C ABBG W (J ABBJ e(J ABBA4AHh PAh AdFAv I ALBBIB A(A0o (D BBBH f(A EBB8XBTBBD D(D0f (D ABBA LBBJA A(D0 (D ABBB i (D ABBA `BUBEE B(D0D8DP 8C0A(B BBBD  8D0D(H BBBJ HC BBB B(A0A8G L@LB 8A0A(B BBBH BNB\BBB%BNBKBABBHBKBEBIBdCBBB B(A0A8G L@LB 8A0A(B BBBF BNBKBAB8@D<RBLA D(G (A ABBB |D`FBB B(D0A8D`2 8A0A(B BBBG s 8F0A(B BBBF f 8F0A(B BBBK c 8F0A(B BBBA e 8F0A(B BBBA X,EPbFBB B(A0D8GP( 8A0A(B BBBF X_`OXAPDEd5FEA D(D08M@^8A0D (C ABBB lE\FBB B(D0A8JM\AJ 8A0A(B BBBH HKFx@F!BBH B(A0D8D@HMP_HB@D 8D0A(B BBBA i HPPG xHFPIHA@ HFPIHA@F%HN\F%BBH B(D0A8JJH^D 8A0A(B BBBE 44G(fFDA I(G0~(D AEBlG( HQG(FIE B(H0A8JWVCEIB\ 8A0A(B BBBE LWVFDDDIH/lBBB B(A0A8G I!!O!Z!B!J 8A0A(B BBBG !R!H!B!L!P![!A!TH3BBB A(A0J 0A(A BBBB lK`A,Ht5BDI o ABG H(Id6BEE D(C0B (D EBBN a(F BBB<tI6KAI J CAE `(T0Z(A CAIx7VEc H eI7BI7B0I08jEGI M CAJ uCAL0Jl8FHA A(G0 (F ABBH L (F ABBA 8J:iBBA D(GK (A ABBG J<BEE B(G0D8N 8A0A(B BBBK QSAILAINi_IE_AHOcRBBBBABBBSGTGeBOAMHLBGDBIIAIN[OKN_HERAHOcFcBJLDxGGGIrAOIc][OKN AL z AL LZAQLYAJ HL 8LPFBA D(G0 (C ABBE LQFBB E(A0G8G@ 8J0A(B BBBF  8A0A(B BBBI HMP\HA@I 8A0A(B BBBI  8F0A(B BBBA \MUFDB B(A0D8G[M\F\ 8A0A(B BBBF \M\9BJE B(H0A8JENAI 8A0A(B BBBK \\N`aFDB A(D0GP 0A(A BBBJ OXM`\XDPXM`\XFP<N eFFHA I(G (A ABBF \N0hBBE F(A0A8G.F`A 8A0A(B BBBK \OmFDB B(A0D8J:MDESDHPAU 8A0A(B BBBD dU^AOtoFBE E(A0D8G 8A0A(B BBBG FJBI^AEIARI_BFIBPgAs D gTPBEA D(D0` (H ABBC o8M@\8A0F(A ABB|Q\ BBE B(A0A8G`DhQpDxEI`Q 8A0A(B BBBJ hZpExEI`ZhXpIhB`Ql FHB B(A0D8J1 8A0A(B BBBD BFAOGDDI/K`BXWARЙAFBH B(A0A8G<EIFu PP WM]B~ 8A0A(B BBBE  PQ @RrFDG _ FBH P FBH JAB|R؞CBEB B(G0D8G`JhGpDxBM`M 8D0A(B BBBE KhNpDxEM`hOpNhA`ddS_BBB H(D0D8DP% 8C0A(B BBBE kXQ`OXAPXE`iXBPtSBIB D(D0 (A DBEN } (A BBBD ` (F BBBA x (F BBBA 0DTFDD DPq  AABI 4xTFDA k ABG RFB4TFDA k ABG RFBLTBHI G0  AABB 8N@Z8B0`8R@[8A0H8UDFEA H(J0[ (J ABBH h(F ABBlUȺFHB D(A0 (D BBBF t (D BBBB R (C GBBH Z8G@O8A0U FBB B(A0D8J  8A0A(B BBBH I_AK`ByK_BJIBlJHA\V$FFB B(D0A8Dpex^MBIp 8A0A(B BBBE @VTFGA G@qHUPPXA`I@e  AABB PFHA D(D0G (C ABBJ E (F CBBF c (F CBBH D8J@e8A0~VFGB G(I0A8JnSOJI\BBNP 8A0A(B BBBJ oMULEEId`FBB B(A0D8LKPIDBN] 8A0A(B BBBF D{FDH P(M0K8D@I A ABE bFB<_D0U A HX$1BEB E(D0A8GP 8C0A(B BBBF lBGG B(D0D8DX]`KXBPZXT`[XAPX 8A0A(B BBBD $Xh`HXAP8hBBA D(L0 (D ABBA XPFBB I(A0A8DMTAg 8A0A(B BBBE LFBB B(A0A8DF 8A0A(B BBBF PbFBA A(D@HSPKHA@Y (A ABBH SHLP`HA@tPFEB B(D0D8DpxMTxBp-xFOxApN 8A0A(B BBBG xL`xApȂ`FJE E(D0D8Jw 8A0A(B BBBC kH[BYCBIFLEI|T FBB E(A0D8M 8A0A(B BBBD  RL MYAGhAdԃ8"FBB E(I0A8G`hMpZhH`}hMpGxBI`f 8A0A(B BBBK H<{BJD F(D@y (A ABBG T(A ABB4BBE B(A0D8GP{XP`QhIpIPFXO`UXBPBXB`fXAPBXB`eXAPYXP`ZXBPPXI`^XAPJ 8F0A(B BBBD tXI`^XBP\XP`QhIpIPGXP`RXAPBXB`eXBPBXB`fXBPMXN`ZXAPOXL`bXAPQXM`]XAP(ADG  AAA T{BBB B(A0A8G L@LAK 8A0A(B BBBB XBBA G(D0@ (A ABBJ D (C ABBD D(G ABB|d, BEB B(A0A8G 8A0A(B BBBC @F[LDCIG`A AG U AB 4AG U AB |,BHE E(I0D8J_MFIFaF 8A0A(B BBBF DMWCVTlG NḢ BBB B(A0I8L@9 8D0A(B BBBD t BEB B(A0C8G  N \ B N N \ A Z P _ A } a F F Q c B B Q  F a B P M Z A  S _ B  N I D B B U o 8A0A(B BBBF t N G A S F N G e G e B q S _ A ] O ` B   S Q  [ H E P   N I D B B M D P ] E } M P E P ^ N Z A I P N I I (8\BKG DAB l BBB J(D0J8NIYCeDeBMYASMZDfEfBIYCfCfBu 8A0A(B BBBC MYCeCeAQMZDfEvACMZCeDeA4BEE E(D0I8GkOFFNP 8A0A(B BBBE {LFFN\FDDBJX@ FDAF \܋BBB B(A0A8Dp]xVFFWp 8A0A(B BBBD <0!cBFB E(A0D8JIII[HFADDOSN 8A0A(B BBBE JMZAcnA\vAIK_BL KI   KT $$0*FBB B(A0A8G L&} 8A0A(B BBBH d&H&\&B&z &H&L ~&M&_&A&t&I&I&I&p& &K&U l &E&G F &M&U &I&`&A&&I&I&I&`&P&a&G&G&D&D&I&Z&T&L&A&D&D&I&&I&I&I&^&h&B&I&I&S&@&I&_&B& &R&_&A&I&R&`&B&H&I&`&A&W&I&I&A&B&B&N&|&O&T&A&D&N&g&D& &O&E N&I&I&A&B&B&N&&N&`&B&&O&k&D&s&r&F&H&\LpYFBE E(A0A8J 8A0A(B BBBH KcF^FBB A(G0 (F BBBC I (F BBBK u8F@I8A0}8F@I8D0Z8F@`8G0A (A BBBD I(F BBBDDx_FDH m ABF >(B0F(A j ABE HPaBEE D(D0\ (E GBBH e(C BBBHؐaFED G(D0V (C ABBH J(A CBB$Xb!8tbQFEB B(A0D8G 8A0A(B BBBI CO^AEDBNMYAHPB`БWZ@L0BDD g CBJ z(I0](A CCB AZPBEL D(D0D@b 0A(A BBBG PHMPOXC`K@BBB B(A0A8G L"z 8A0A(B BBBG <"T"L"A"T"T"L"A"~"I"O"J"K"@"T"M"B"P"D"_"B"\[BNA H0S8P@R8F0X  AABH f8G@Q8C0a 8O@O U 8G@B H AGL M(M0a(A I AAE f(O0H(A FAA|XBBG L(A0A8DPXR`tXBPbXN`[XCP 8A0A(B BBBK XK`\XEPlXO`IXAP0BAA DP|  AABH \ ACI R(F0a(C D AAA M(F0Q(A F AAC D (N0N D(N0(lBAA w ABB (AIJ P CAH HBAA G I ]  AABK x M O C L d<"BBB B(D0F8D`8 8F0A(B BBBC  8C0A(B BBBG xEW A qD 8LD Ar$8 84L0 4`,EMD  DAF s DAH @sFAF H ABH b(F0c(C AAB`PpFBB B(A0A8D`6 8A0A(B BBBF thKpehA`W hKpN \@\FBBE B(D0D8J 8A0A(B BBBG MSALBBB B(A0A8G L@LDi 8A0A(B BBBD DTDLDADDMDMDQDLDDDRDMDAD\0BEE D(D0y (A BBBD } (A BBBD F(A BBBl;FBB B(A0A8GE 8A0A(B BBBD SUZANUZALBBA A(G0D (D ABBF m (D ABBJ 0P\]EIJ N KAN INA (EAG_ AAB (EAG_ AAB (EAG_ AAB (0 EAG_ AAB L\^FEA A(J{ (A ABBH HMAT7FBB D(A0JNSAR 0A(A BBBG  ,@ T h |$xEr I N B gDEDD@^HPP`HA@{HIPTXJ`R@b AAD DEDD@QHPP`HA@J AAE zHMPOXC`R@H<TT`,'FBE B(A0A8Gpy 8A0A(B BBBE wx`PxApkxTLxApx^NBRpqxRMxBpyxMOCVpxTMxBpCxMPQKp(9HEE I(B0A8B@X(D*HGC D(B0A8G@I(p4HMF J(B0A8B@I(FMIL B(D0H8B@I . $ EB I ^ B i@ T sFBB B(A0A8H Q G9 8A0A(B BBBG aEAE^~MTTHjK^OHaTLA P FBE B(A0A8D`M 8D0A(B BBBA hMpOxCO`hTpNhB`hApHxHg`QhMpOxCL`GhMpOxCQ`ZhTpNhB`bhApHxHf`F hApHxL AhApHx``BBB B(A0A8G I g I U F P Z 8A0A(B BBBA @8_X<XBEAG L!| AAI m!T!L!C!`FBB B(A0A8G L@LB 8A0A(B BBBG 9BTBMBDBfBTBLBABxBTBLBBB0 EID { CAG |CA4TXFDI z ABH [ABENRH_ I d(VBAA F@@  AABB oHlPGHA@HMPaHB@vHOPHHA@~HOPIHD@, b@| Tx:TO E Ntt@BBB B(A0A8G L" 8A0A(B BBBG "P"P"C"j"M"O"C"N"<`nBBA A(G L!x (A ABBI ,BBB B(A0A8G L@LC} 8A0A(B BBBH CLC\CAC@CNC_CDC`CGC^CBCcCLC\CDC|CMCOCCCPC"FIB B(A0A8DLULG 8A0A(B BBBF dOMAONZBTLBhTMAHOCLDRMAuKOQP D'dEG x AK 'aFFB B(D0D8FG}OY 8A0A(B BBBG fGRKRNCAFBBBBBHDDDDBHFHFFAAHXR GK 4,EAD0s AAA d8F@a8A0 ,OED } CA ,,{EDD0R AAG $L@-BACG qDA8th-BJD Q(F0^(A D ABC <-sAJG Z(M0^(A G AAG HAA(.{AM [ AF IA`p.BBB B(A0D8D@ 8A0A(B BBBG n 8A0A(B BBBH @,2BBA A(G L"h (A ABBI $4PAC C B 006QAAG t FAD DCA0 \6BDD I  AABA (T7BDI } ABA 47qBDA n ABH mABX8/BBE E(A0A8GPi 8D0A(B BBBC XE`\XAP9XHPJ A 00,:FAA D`o  AABA @d:AAG w DAK G(Y0[(A G AAK d;=BFA s(P0g(A D ABE z (P0N  (P0R N (P0R  (P0Q K (P0U t>BBB D(A0G@UHPPeHA@D 0D(A BBBD f HPPR | HPPT U HPPS S HPPU H4CBEE J(D0D8D 8A0A(B BBBE DCAA8DBIA D ABE A CBB ,,PEAC M D @\KBJL D(D0G`g 0A(A BBBJ HKAJF Z(M0^(A F AAA H CAL NAA0LFFA G`g  AABA @ LVBBB A(A0D@ 0A(A BBBG 4dMEMD j DAK o DAD `N \N XN TN#pN lNxN4(NEDD m DAA j DAA `NtOO O,O8ODOXHPJ A OHV O O4OHOCdX`O tOOPHVPP P ,PEQPg AB PEQPh AA 8QEQPV AC \QEQP\ AE QEQPR AG XRaHPS A R(RGFIA _MBLRFBA A(D0 (D ABBG _ (D ABBH P,T 4d(TFID y ABA m ABH TT TT ,T~FAD G ABA UOH4HUBBB D(D0| (C BBBE F(A DBBHUBEE J(D0D8D`  8A0A(B BBBG HW#BEE E(D0H8DP[ 8C0A(B BBBH T dYBGG L(D0D8DPUXF`JXFP[ 8D0A(B BBBE Lp ZQBEE D(H0S (C BBBD q (C BBBF D [BDH n ABA w ABF j ABC T \BBL E(D0D8DPdXF`JXFP[ 8D0A(B BBBE ` ^<DQ f| ^|AB M kX P_BBE A(A0G`hNp]hA`c 0A(A BBBB hJp^hG`0 `pADG h FAE kCA$, a[iGG aAAHT HaBJD D(D0~ (D ABBA m(D ABB4 avBDD s ABH hCB a6BEE E(D0C8L@cHOP`HA@V 8D0A(B BBBF hHOP^HA@ HNPQ D HOPU D HOPM Q HNPL 4` cRDG e AAD LAA0 doADN M DAK zCAP @dBDC g ABE @ ABE H(v0M(D A ABE dBEE B(A0A8JMSAJWLaDG 8A0A(B BBBC MMSAJ4 $hmAFG ](]0P8E@G DCAH \hBBB F(A0A8Dp 8A0A(B BBBA ,j\@j BEB B(A0A8Dpj 8A0A(B BBBK xeDGQpEtL.d{FBE B(D0D8G 8A0A(B BBBJ l.0i[Eb I j.piT.lixFEB B(A0A8D`hTpWhH`n 8A0A(B BBBD .j< /jECF W AAI D DAG LDA`L/k?FJB D(D0 (F BBBE v (C BBBI S (F BBBA /k(/lEG P AK XC/l40lFCD  ABE kABx<0m|FLB D(A0N8D@M8A0^ (D BBBG 8K@e8A0b (D BBBD  (A BBBF 0o6LL H I0oHRX0oX FBB B(A0A8G`_ 8D0A(B BBBG hKpWhA`|P1ySBBB B(A0A8D`N 8A0A(B BBBJ J 8F0A(B BBBG  8D0A(B BBBE 1}1} 1} D 2}FPA Z ABD o ABF w ABF T2~OBD I(G0 (A ABBC ~ (C ABBJ H0m (C ABBA 8[@U8A0L8[@U8A0P2 SDD F(v0F(A Z(v0F(A OAAJH mCA\43HAFFD A(D0{ (C ABBH j (C ABBF `(C ABB$386EFD bCA3PaH3FBB B(A0C8D@ 8C0A(B BBBA D4IJD O FBB j CBA q CBJ d4ȅEJ AA 4"EXH44FBE B(A0A8Gp 8A0A(B BBBC 4K A  503 5\VL45NFGE D(D0w (D BBBE l8N@SHMPG0T5FEE A(G0Q8N@W8A0A (D BBBF h8J@`8A05PT5606EEGI S CAD PCA8L6ЌFED D(GP (A ABBJ p6FHB E(D0K8GIbAa 8A0A(B BBBA LdB6;IpAL7FBA A(D0 (F ABBC o (A ABBK lh74FBB B(D0A8G`hMpWhA`f 8A0A(B BBBC hLpZhB`zhMpWhD`p7FBE B(D0I8D`X 8A0A(B BBBF ]hIpIxILEEEEEK`XL8FEI D(D0~ (F ABBK { (C ABBE j(C ABB@8T'FEB I(D0DP 0A(A BBBE 48@ EED0\ AAD `8I@S8A0X$9FED I(D0k (A CBBA o (C ABBI u(C ABBL9FED I(D0l (A ABBB M (C ABBK H9L[FBB J(A0D8D 8A0A(B BBBJ :`SE[ H jH<:LDL RCAFH Z(M0T8T@[ DAA:0:0.:L :H ,:@BDD B ABA 8 ;FIA g ABA K(G0a(A $H;$_EDD HDA,p;\FAC j DBF ;4;FAA F HZP HAB;@;<lw|]F8 <FBD D(G0 (C ABBH \<%p<(<FFGD nDB4<ܭ`FHD D(D0|(D ABB<*EdT=FIA A(D0g8F@b8A0Y (C HGNR D(H ABB\=Юp=̮H H hH=@FBA A(D0 (D ABBF f(D ABB0=NAAD o CAG ICA0>KADG c AAG PAA(D>ȰADG L AAF $p>tyDL oAAFR 4>BDD A JBI jABL?XBEE D(A0 (A BBBC A (F BBBC 8T?ȳBLD E(D0c (D ABBI H?| FBB B(I0C8Dp 8A0A(B BBBD 8?0FBA D(I@ (A ABBA H@ľDFGB B(A0A8Np 8A0A(B BBBH d@A0x@KAD D AAJ {H@!BEE E(A0G8G@l 8A0A(B BBBA @BBA A(D0} (A ABBC r (F ABBC P (A ABBJ x (F ABBE - (F ABBH L (F ABBA s (C ABBE DApBAA  ABF  ABK  ABA 4ABAA Z ABG  ABF H$BBBB B(A0D8Dp 8A0A(B BBBK @pBWFJB D(D0D@ 0A(A BBBG $B-EGG IKABd`B\FEE B(D0A8H@ 8C0A(B BBBE d 8F0A(B BBBA ,TCXFID X ABB CHtCCP4CcFAD B CBA CJB(CJFDG sAAA($D(?FDG gAAAPD<G A HlDBEB E(D0D8DPB 8D0A(B BBBG DTkLDFBE B(G0A8GP 8A0A(B BBBG E FBB A(A0G L"w"O"T"B"g 0A(A BBBF "n"F"A"i"O"T"B"[ "O"H m"K"b"A" "L"Q ^ "O"K a "O"H W "O"E E(EDG r(K0Z(D _(L0\(C \(L0\(C \(K0[(A P(U0X(D V(I0\(D \(I0\(C V(I0\(C N(U0X(A P(U0X(D N(U0W(D q(V0W(C D AAE e(N0[(D Z(H0\(C FcHF,BEB B(A0A8DPv 8D0A(B BBBA 4GCBED F(D0d(D ABB(TG?BDC rABDGBKE B(D0A8GP|8D0A(B BBB(GEFK A DAD G%E[H<Pk`(HFBE B(D0C8L@o 8A0A(B BBBE o 8A0A(B BBBG H@@Ez$Hd,EGG IGD(Hl.FDG RDB$Hp,EGG IGDH$Ix{FEE D(G0F (E BBBD A(C BBB4pIWFED G(G0s(A ABB4IaFED D(J0}(A ABB\I FEE E(A0A8JP| 8A0A(B BBBI D8C0A(B BBB@J|4TJxVFED D(D0x(A ABBJ?EyJ J J4J;J K Ab$KH;\8Kt$LK)EGG IGAtK KK K|EUKEVKEVLEU L!44LEAD b AAB h AAE ,lLBEA v ABG L\LLBBA D(K0T (A ABBB | (F ABBI K (D CDBH MBBB B(A0K8D@ 8A0A(B BBBE E 8A0A(B BBBA N 8C0A(B BBBF @ 8F0A(B BBBA `MBBB A(A0a (C BBBA k (C BBBA X (C BBBA x N0BBB B(D0A8G` 8A0A(B BBBC f 8A0A(B BBBH ` 8D0A(F BBBG <NTBBJ D(I0I (A NBBA 8NBBI I(G0x (A ABBA 8O8BJA I(G0 (A ABBA `@OBBB B(A0D8DPM 8A0A(B BBBH y 8F0A(B BBBH OHBBE B(A0A8DP 8A0A(B BBBH  8A0A(B BBBJ l 8L0H(D BBBF j 8A0A(B BBBA `_BX ?IS] @ @U .H]iy@@ @ @ @@@  y w>w>E8mK8Spw>R86)FV8>w>`\8   ! ! `k H  H     `k K    H I @I  I   `I y I ` I    I y I  J    J J e @J `J 0  J   J J E     P  К      K P7 0 H                 w>G|ooƘԘ(4<DM\nzΙۙ#0=G log_seq_numSeq ׭log_typeLogType log_contextContext log_object_typeObjType  log_object_nameObjName (log_object_idObjID 10log_object_groupObjGrp D8log_object_group_idObjGrpID Z@log_messageMsg s Hlog_errnoErrno@  Llog_ret_codeRetCode@ devtype_nameDevType  devtype_max_partitionsMaxPartsP  devtype_descriptionDescription &lv_uuidLV UUIDU lv_nameLV @lv_full_nameLVP] lv_pathPath\ lv_dm_pathDMPath\ lv_parentParent0\ ( lv_layoutLayout`[ î lv_roleRoleZ ή lv_initial_image_syncInitImgSyncP( h lv_image_syncedImgSynced*  lv_mergingMergingP* ؼ lv_convertingConverting ( ׮ lv_allocation_policyAllocPol  lv_allocation_lockedAllocLock'  lv_fixed_minorFixMin' 8 lv_skip_activationSkipAct' h lv_autoactivationAutoAct`' lv_when_fullWhenFull0 lv_activeActive0Z  lv_active_locallyActLocalY  lv_active_remotelyActRemoteR  lv_active_exclusivelyActExclY 0 tlv_majorMaj@ X xlv_minorMin@ @lv_read_aheadRaheadPK Ⱦ@lv_sizeLSize #@lv_metadata_sizeMSize@  seg_count#Seg @originOrigin` 8&origin_uuidOrigin UUIDk p@origin_sizeOSizeX  lv_ancestorsAncestorsP<  lv_full_ancestorsFAncestors ; 0 lv_descendantsDescendantsg p lv_full_descendantsFDescendantspf  raid_mismatch_countMismatches`  raid_sync_actionSyncAction 0 raid_write_behindWBehind 8 p raid_min_recovery_rateMinSync7  raid_max_recovery_rateMaxSync@7  raidintegritymodeIntegMode Z raidintegrityblocksizeIntegBlkSize0X m integritymismatchesIntegMismatches @move_pvMovepo h&move_pv_uuidMove UUIDa convert_lvConvertk &convert_lv_uuidConvert UUID^ 0mirror_logLogPl p&mirror_log_uuidLog UUID^ data_lvDatal &data_lv_uuidData UUID`_ 0metadata_lvMetam &metadata_lv_uuidMeta UUID_ pool_lvPoolpm &pool_lv_uuidPool UUID@` Xlv_tagsLV Tagsh lv_profileLProfilej  lv_lockargsLLockArgsp lv_timeCTime`W lv_time_removedRTimeV 0 lv_hostHost0V Xlv_modulesModules]  lv_historicalHistorical*  writecache_block_sizeWCacheBlkSize U  lv_kernel_majorKMaj  lv_kernel_minorKMin @lv_kernel_read_aheadKRaheadT 8lv_permissionsLPerms ˯ lv_suspendedSuspended0 ۯ lv_live_tableLiveTable@0 p lv_inactive_tableInactiveTable0  lv_device_openDevOpen/ data_percentData% snap_percentSnap% metadata_percentMeta%0 Pcopy_percentCpy%Sync sync_percentCpy%Sync  cache_total_blocksCacheTotalBlocksD  cache_used_blocksCacheUsedBlocks`D ! cache_dirty_blocksCacheDirtyBlocksD 4 cache_read_hitsCacheReadHitsC H cache_read_missesCacheReadMissespC Y cache_write_hitsCacheWriteHits C l cache_write_missesCacheWriteMissesB ~kernel_cache_settingsKCacheSettingsS kernel_cache_policyKCachePolicyP  kernel_metadata_formatKMFmtpB Hlv_health_statusHealth0  kernel_discardsKDiscards0R p lv_check_neededCheckNeeded0/  lv_merge_failedMergeFailed.  lv_snapshot_invalidSnapInvalid. vdo_operating_modeVDOOperatingModeQ vdo_compression_stateVDOCompressionStateP @ vdo_index_stateVDOIndexStatePP p vdo_used_sizeVDOUsedSize`L  vdo_saving_percentVDOSaving%  writecache_total_blocksWCacheTotalBlocks B ߰ writecache_free_blocksWCacheFreeBlocksA  writecache_writeback_blocksWCacheWritebackBlocksA  writecache_errorWCacheErrors0A  lv_attrAttrO (pv_fmtFmti /&pv_uuidPV UUIDM @dev_sizeDevSize0 P pv_namePV Apv_majorMajp Gpv_minorMin \@ pv_mda_freePMdaFree @ pv_mda_sizePMdaSize0  pv_ext_vsnPExtVsn`O q@ pe_start1st PEp @@pv_sizePSize @@pv_freePFree  8@@pv_usedUsed p@pv_attrAttrO (@ pv_allocatableAllocatable0' @ pv_exportedExported' @ pv_missingMissing& @ pv_pe_countPE (@ pv_pe_alloc_countAlloc P@pv_tagsPV Tagsh @ pv_mda_count#PMdaP @ pv_mda_used_count#PMdaUse @@pv_ba_startBA Startp @@pv_ba_sizeBA Sizep 8@ pv_in_usePInUseP. @ pv_duplicateDuplicate) h@pv_device_idDeviceIDN @ pv_device_id_typeDeviceIDTypeN vg_fmtFmti /h&vg_uuidVG UUIDPM vg_nameVG Avg_attrAttrL ( vg_permissionsVPerms ڱ vg_extendableExtendable)  vg_exportedExportedP)  vg_autoactivationAutoAct&  vg_partialPartial(  vg_allocation_policyAllocPol 0 vg_clusteredClustered) F vg_sharedShared( ^@vg_sizeVSize @vg_freeVFree0 vg_sysidSYS ID 0 vg_systemidSystem ID 0vg_lock_typeLockType h vg_lock_argsVLockArgs @vg_extent_sizeExtP  vg_extent_count#Ext ( vg_free_countFree  max_lvMaxLV  max_pvMaxPV P pv_count#PV s vg_missing_pv_count#PV Missing  lv_count#LV  snap_count#SN0  (vg_seqnoSeq vg_tagsVG Tagsh vg_profileVProfilepj  vg_mda_count#VMda ( vg_mda_used_count#VMdaUsep P@ vg_mda_freeVMdaFree @ vg_mda_sizeVMdaSize  vg_mda_copies#VMdaCpsH segtypeTypeH  stripes#Strp 0 data_stripes#DStr X@reshape_lenRSizeJ  reshape_len_leRSizeG  data_copies#Cpy7  data_offsetDOffG  new_data_offsetNOffG  parity_chunks#ParP X@8stripe_sizeStripeP @region_sizeRegionP @chunk_sizeChunk  thin_count#ThinsE XdiscardsDiscardsj  cache_metadata_formatCMFmt`@  cache_modeCacheMode  zeroZero-  transaction_idTransId0@ P thin_idThId6 @seg_startStart0  seg_start_peStart@ @seg_sizeSSize X@seg_size_peSSize0 seg_tagsSeg Tagsh  seg_pe_rangesPE Ranges?  seg_le_rangesLE RangesP? (seg_metadata_le_rangesMetadata LE Ranges> pdevicesDevicesp>  metadata_devicesMetadata Devs> seg_monitorMonitor= @ cache_policyCachePolicy2 p cache_settingsCacheSettings  vdo_compressionVDOCompression-  vdo_deduplicationVDODeduplication,  vdo_use_metadata_hintsVDOMetadataHints, ( vdo_minimum_io_sizeVDOMinimumIOSizeJ P@vdo_block_map_cache_sizeVDOBlockMapCacheSizeK x vdo_block_map_era_lengthVDOBlockMapEraLengthp6  vdo_use_sparse_indexVDOSparseIndex+ ײ@vdo_index_memory_sizeVDOIndexMemorySizem @ vdo_slab_sizeVDOSlabSizen  vdo_ack_threadsVDOAckThreads6  vdo_bio_threadsVDOBioThreads5 @ vdo_bio_rotationVDOBioRotation 5  vdo_cpu_threadsVDOCPUThreads4 h vdo_hash_zone_threadsVDOHashZoneThreads@4  vdo_logical_threadsVDOLogicalThreads3  vdo_physical_threadsVDOPhysicalThreads`3  vdo_max_discardVDOMaxDiscard2 (vdo_write_policyVDOWritePolicy@1 `@ vdo_header_sizeVDOHeaderSizepI  pvseg_startStart  pvseg_sizeSSize &3` w>w> < @O SO nO O @ 0 @ ̳P w>w>O(h w>w> pEKDEw>pKDEw>`KD`Ew>PKD@Ew>@KD Ew>0KDEw> KDEw>KDEw>KDEw>JDEw>JD`Ew>JD@Ew>JD Ew>JDEw>JDEw>JDEw>JDEw>pJDEw>`JD`Ew>PJD@Ew>@JD Ew>0JDEw> JDEw>JDEw>JDEw>IDEw>ID`Ew>ID@Ew>ID Ew>IDEw>ID Ew>ID Ew>ID Ew>pID Ew>`ID` Ew>PID Ew>@ID Ew>0ID Ew> ID` Ew>ID Ew>ID Ew>HD Ew>HD Ew>HD Ew>HD` Ew>HD0 Ew>HD Ew>HD Ew>HD Ew>pHD` Ew>`HD Ew>PHD Ew>@HD Ew>0HD Ew> HD Ew>HD Ew>HD` Ew>GD@ Ew>GD Ew>GD Ew>GDEw>GDEw>GDEw>GDEw>GD`Ew>pGD@Ew>`GD Ew>PGDEw>@GDEw>0GDEw> GDEw>GD`Ew>GD@Ew>FDEw>FDIw>FDIw>FDEw>FDEw>FDEw>FDEw>FDpEw>w>Xw>Ww>w>w>;$ :$ w>C;C1CeYYGGFFEEDD[[ZZ        p1e~~vvuuttgD}htƵʵѵյ޵444LfL*Ldd_d | ͵ #+/8< B FLP$T0Y0]<b<fHmHqT{T``llxxsd5ide@?mdHloopdramdiskpdevice-mapperymdpdasdxdac960nbdidacciss®ubdataraidծdrbdemcpowerޮpower2ޮi2o_blockiseries/vdgnbd aoexvd0vdiskps3diskIvirtblkemmcqblkextfiomtip32xxvtmsskdůscmbcacheʯnvme@zvolVxDMPw>|W   @Ethin-pool@@Ethin p @P0  @D_ p8r 8e8r88~88r 8l88 8u 8r8 8r 8wd8Im 88r8r8$r8) selectedSelected8 helpHelpP ?HelpP helpHelpP ?HelpP[cw>w>Lpl   @ p p z=x?y?B  '$& "#!+, `(%```)*@2-30.0m0lP9 T i z         @ h`CpCo`` gD  P, oH*ooo*ooH(oeDp 0@P`p   0 @ P ` p            0 @ P ` p            0 @ P ` p            0 @ P ` p            0 @ P ` p          0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p PQGc G@OJ8@/pDpD pD pD0pD0pD@pD@pD0P %?I70-,&@  %PDF,&@ `h}cD9Q `mMD(: `:%A :` h;3 ; ں B? ; r$;  ` auD<MbcDP<`cD=` @cD>Ѫ ` 8>b*"` >a"H$F aUD>*a ytD@o8 -oFAFa"B$CVa F0F` fa F(Gua  FGn"a Ja"abDOޯ  $a $PFa w>$F a F!A*D XQ"a R#aDR$aYDU%a b FU&)b `V'@b FPX(TbpDXZ)pb0DZ*bKDH\+b3D],b-D_-a2D a.b$0c/bhDc0bKDF1bIDh2cUDPh3#cUD i4kDk52cFn6Jc"@MDn7YcUDxq8hciDycr9XtiDt:xUD8x;cDx<yjDy=c qDDzc>cDXz? D{@ק pD@|AD|BADX}CcpjD}DcpDEYD؀Fd FG(dcDH7d ̷cD`IJd fdeDȂJnd FK|dpcD LdpDMdFȆNdFOdFPPdFQdFRe?FS,eFFЋTFeFU[eFHVteFWeFXeF Ye@F@ZeF[eFx\eF]eF@^f F_fFp` Fa&fDb9f JfDPcVf Dxdgf D0eoa f}fbDPgf hf/ @ @ia" Fjf 0kf hlf mf Hna J o pf H qf"cD@r@"XFsR"XFt%A Xuf  `v wf  pxxf Ыyf zfd ({g? `|t Ь}k D @~ g6Dh`e x !g Fh  F2g"@ FCg"@ FVg Ug [gzg yguD~g(g Fg2D`g*DFg*DFg g g h4DX h @ ,h  Fi i^Dii jdD!jH1j HjdD^jpj"`Dj"jdD j"BcDXj"BDj jlDjk klD3k@Dk \klDskk"lDk"jlDpk kFkk"jF k"B F`l #lD3lP@l yuDQl @uDXMbVD`lxDmllDl FHl3Dl9DlVDlYDl  hlYDm@ m `%m Fm"B h6m"BaDhRm"BYDHhm cD{mcD ?XsDs  m mYDHm 09Dm m$m e $9DmdKDnKDhdYD3nYDp PndF nnF n"D>Dn>DUa?D@n?DncD`n nlDn"B|Dn"B|Dx nD oD %oD f H WlED @o@ (  OoED@# )@ `o"D F eo Fpo Fzo F F H F o oD# osD% o w>D0' \ ( j ( d * h m> @* o olDp* d$D* k'D* o + olDh+ o p{D@, p &peD= 3p p>eD> Ap p>eD ? Wp `p ? pp @ @ yp @ A p p 8B p B B p PC C p p (D p D D p 0E pE p p E q pF F (q G pG p q"G q H"G &q H"@I :q HqDI Oq ]qDPJ dq rqDJ yq qD@K {q qDK  q pDHL  q pDL  q `pDHM  q qDM  q rD`N rDN )rD O Ar O$O Pr PWD ]r Q$0Q nr @RYD`R km {rD`S r rFT m {rFU j rIDrV r V KS @W"B Y r uDZ r"BuD8\ s|D]pww xwwzPy0yDD 2P(@`0$6 6575ppS0SDCCPC<p `PP` s@c@0`P       X PW `b T ] O \ [ @Z O O `O 0O none p p p @   q hp  ` 0    ȣ ޣ     1 @ S e r |    @  ` ɤ פ ߤ p e P 0   1 @ T hp yP 0  ggP 8g P ͥ ե   h` 0     p *@ 2 ? G R ^` f0 v ~     p ̦ ۦ    (  $ 0 5  B  O a t     Ч      , < P c y    ¨ ٨  P 0 Q  p   ' 3p ? @` @JP @R0 @Z @b @j @y @ @ @ @ @ @é @թ @ @ @ @ @ "` )@ p 1 9 H V b t       Ī Ъp ݪP    / 6@ "` 0 + 4 ? H P [ hp zP 0  Jf )   @ A ̫ ȫ` ث ʜ @ ' @ | c  ` 7   r     P ) 7 Q N _` ק  k { d d   Fe  լ e e e e e e e f f  q @ w>  Ew>EEEEEE(E(E Ew>w>hEhEEEEEEE@E@EPEPEw>sw>sw>sw>sw>sw>s);NZ1D6e})oLLLLLLLLz,z,~n~nehehɴԴɴԴٴٴee  !!)5)5;hu;huqWqW&W&WMSMSZhZhm1D6e})ohhaatstsKK66]]TTQuQu!swp{ } x w v | { pv @v v   p ` 0 P  @  `  P @  exPJ{QpEpE 0p p@P0p h}8B`l?pB?8BP_"?Bl*?5?&pI?B0Qc?B@#@P#Qk?@iQ?@P?&`?@ ?H$?8Bpl??Б?  @@#)@0@#G@`=@e(@N@W@@0o@@ƜX&`@&@p@ @0m~ [@8@$@p* bcX`|@`@@`.0@@" @ABP$3j@BOBp$B P AЊ& ,A9A @7BA@$DGAp%v~QApEgA&PqATzAYA ^AA`_AHwAA{AxAPeA BB+B& /B6B&SB u&uuuuuuuu0:uu v@vu0Buv vBv v*vB5vvTw^wiw?uwwhwp?tw|ww?www?www@wwwp@wwwpFxwaxCnxPx xpCx"x7xCDxMx`xCmxvxxpDxxx >xx! DxH}x"`Exx}x#Ex}x$0Eyy!y%E/y9yJy&G_ypyy'HyyLy(0Hyyy)Hy~y* Iyyy+0I zz!z,I2zI?Д1I@GIA @BxYICoIIDIIEIIFIIGJ!JH4JCJIXJJؕiJKJJLJJMJJNJKOK'KP=KOKQgK{KRKKSKKTKKUK LVL/LWBLQLXgLyLYLLZL[ L\LL]LL^M3M_PMiM`wMMaMMbMMcMMdMNeN)Nf?NQNg`NkNhzNNiNNjNNkNNlN OmO-OnBOSOohOyOpOOqOOrOOsPPt,P?Pu]PwPvPPwPPxPPyQ%Qz;QMQ{bQsQ|QQ}QQ~QQQ RR+RDRYRoRRRRRRRRR S"S3SDSQScSqSSSSSSSTT5TGTXTeTxTTTTTTTTUU/U;UNU]UoU}UUUUw>UUHU3tUtUKjVޯU]UkV k V V(V tH3V Vw>VVVVVWW W.WDWYWkW|WWWWW WW X"X 9XOX ]XjX yXXXXXXXYY1YKYdYxYYYYYYYYZZ)Z[-[[@\\)\4\ =\H\ (Q\\\ Pe\q\x{\\\\\ \#0\ \\ \0\ \] ]%]<]Q]`]h]] ]]`]] ]]] ]^*^ 8^F^R^m^w^ ^^^^c^x^^-^__.`_1_A_Y_(o__h__ _ _x_!_a"_ _#`p`$`x'`%8`(G`&P`0W`'i`Hy`(}a`)``*``+``,`(a-!a8a.MaP`a/yaaa0aa1a@a2ahb3bp!b4-b`7b5BbKb6]bmb7ybb8b8b9bb:b$b;bb<bbnn=c&c>0c8c?IcXc@jc`zcAccBcPcCccDcyfEc dFd`@nGd1dH?dKdI[didJud dKddLddMdHdNddOdePee-eQ?eOeR\egeSre{eTe@eUeeVe eWe9kXfiY ffZ%f)x5f[FfUf\ff uf]ff^fc_fpf`f'fa gpgb6gOgcegygdggegXgfgmgg ghggig/hjh hk*h,/el9hPGhmZhkhnvhhohhhph hqhhrhXhshiti*iu;i@Jiv\iliwi`ixiiyiiz)i{im|j+j}j0$j~1j@ cqlyq@>qlqx>tlqFqlqq3]LqGqMqHJqj rJrk'rJ;rKTrPLkrmtrL=cm{rMrMr 0TonrTrnrUrnrXVrnrrosVsOsHZsp5sZJspYs[fsPrs[|sPssqs\srs%`]srs^sRssR*X^tst^]cs1txb$H$H%H%H %H %H0%H0%H@%H@%Hw>` Preport(H (H8&H8&Hp&Hp&H`k[w>)H)H0)H0)H@)H@)HP)HP)H`)H`)Hw>LVM-/sys//dev/mapperJHJH21 ZDlooot^8h> >>K`@ ` @ x r^ @% p CIm>MVZdwhrv n'ymS=*mMVZdwhrv  %jNHNHGA$3a1@u GA$3p1113$ݠGA*GA$annobin gcc 8.5.0 20210514GA$plugin name: gcc-annobinGA$running gcc 8.5.0 20210514GA*GA*GA! GA*FORTIFYGA+GLIBCXX_ASSERTIONS GA*GOW*GA*cf_protectionGA+omit_frame_pointerGA+stack_clashGA!stack_realign GA$3p1113ЕhGA*GA$annobin gcc 8.5.0 20210514GA$plugin name: gcc-annobinGA$running gcc 8.5.0 20210514GA*GA*GA! GA*FORTIFYGA+GLIBCXX_ASSERTIONS GA*GOW*GA*cf_protectionGA+omit_frame_pointerGA+stack_clashGA!stack_realign GA*FORTIFY&GA+GLIBCXX_ASSERTIONS GA*FORTIFYЕݠGA+GLIBCXX_ASSERTIONSliblvm2cmd.so.2.03-2.03.14-15.el8_10.x86_64.debugNZ7zXZִF!t/]L]?Eh=ڊ2N gC+i3ҳu!f7=9mh466C&gS#H, o[q(e7~@D6n_(K_-Ĉ|̯#!scMa@NT}g}M*0r%kT1!W@G W竅Ix#rG7Fs<*uI(! Ȣ`bTta$O#ibg:1(k/EX07SMIBy^rsK/uᚮ9%2Eu-@=h"%6&Rtw6+0r-_iAQcȽ2ѱ WZb+iςdE*ޛ [ym8vt#ڨIiG !xm!'GB ?Jvj GYB]o~#84s3̴8 "5[wYԩ~-#/āĖNz֨G0}wj4(5իZF%}ѥ7ĸPR(c.# | fx)ӊpK =Df)oZHDPUpwdK^P"h(n޺wovUф&C_.]5oLvV`Yk"+qi::߱o"_%jM(:lVlåx:D+ٮ홻hX>I)H>/lNdQtmh]=;Źݒi&,M6Jrc\O=B WauB7X$2wuClTJ%7r(#J$f) eLT{/0}\S;+rC@Fyɧ,ﮄkZCP~buϏ@D'+Cbr{M E\YL;:^ U/N҅_l&AcN?W.s~W!0Պ;̟$ق3__,$ßSNKٓ'!y2WLJ[2a$ӂDSΟ\dNGiLRe 7艇G=֫ 6 +/85җ>k$ԎDqZO$]Lo;nq~غ'"W7B_|w3Q8[Ajw͇ W1_C:iϒ7әӉ!dֶ?2^v#vHh/_0C~mLٍ!8q#2o!:hf{TC*f,Pozμ{AzaUG < "0+:Ĉ\I<%1_3~ȅ cenM!ۯPƜT\sI6-~L " l\fb{<8|>!bYmlHʝj7HJg!ݿ?qm EDf?cqfxyB5T GVHʮ!S xHo``)2![ܮLl?_v)#|](7 K?Jp3m;MÛYo6 ֪oyC= I;cUUBƴ1ØhF]a[);'.F>a#K5~;:°(QS/6Vg;$< iSx5>:Z ~yyد=sx66[肴E‰V89VtP9`OrvxiGb8iy)8fwF!+aW&z k:9/Y'2;p! ƅv|-kBQϟx㯼"+ޠx &De(/RV7 P!8u;ucmSn{є2oKd?5ȵ׃*TzM~du+V[٣ ' ;#FEa<ur`+&M,~ЋmM@SPE^^;qUGau?C@s{oi N[mjR_(D[\a9ݞ1 o!!6ۢb3e GiyK}md:@u @!2?l%s-bݣjAܣrtޝ{~^ RǴIIzSN) x=le_GT1N㌆~jf̆Q̊ l.Elp >4䂘d"rë7{9}LRR#b ,8ܝM 5c0+6NY6#hG-gg;qcyl챼 "ĔRwZG=HoWqٴx{JJp7QL-I"m iSD<^B47RQ*g|3% ("߱զG'C9_XJ݂͆Fps;\~WF/F>bFl6S9l+@Qf ! :Q,\۱ú*EE lc޿clES'ЗQ\FFoxKu=h`ˣY_"Iz!'TWr k4hDUVlS]8㨟q.593?iO>=±is(ɽb4R?82ْ޶W%#{v1ĔDk@ZN˶0ibp rR]-,1oTˊ9 # xP64+SHyJ/ @TM'oo,a Jۛ1-"/Xw ` s|Kvv׭m%L <q ^ՙmYo4{T%'vs J2[b?G)htWz0Z"_A@ҔS.We%]P QH=$(UY`Ξw~_kP4۾4&*p )#!8ԐuwM7'b}Z|@ḙTBZlf iyT_MfoŚD@_/<6ce>Y.0"=&kmR hT2ls<ޫ`7:Ĝ;?|H3'U+pw˕6pf~Tq!?tJ^r&DXoAk[jH=p{_4'P1R[F]:^>xS̴ Mj\R b~C+Y鉩EC4jm4ұ| lLš*!r{5 f+kߙpP*u!/mSY vdYPI8JHșT:*d-|v#&5kC!{ 'xSTmY 1%*dw0GŨO՟GA]v/cT KCGE[zIRq4]|x@ :SS7(H'g4MHlZCKLiPBͰ }=Gu-ߩdj0iBq*ز| _d @$ϫ?k°[M,.T^p*x]#Z H9Z ٿ~V뻰 _*!x/_q҆8@Z^q"*LJLl,W+2YopN=4D*0vTR_ ơQטyj@Kd,ZMbUr!ְNLR{$CXƓFC%DEVu9 5 @>pْފ򝢊CNv$LFV.EO5׼ qze !dOnNd=]:EG2!>2Nـ$#z^L"Lx?p ?w?kOImCreBSïlƲx}֩l* !$Q[#&垳bJDlA4|w@DRݬ; z6Lt(28zTU+CDN'1ml.6~>c8Ua~X\`*]6\AP~zcSDJftu[ gۍz.} kT}*}9dC#TVq_y Cr nhm(Ea#4EƆc6d_jFk|0# MW68˔`"ޓ\\>I2D6xŚ`2>VZY*+茭Ж\0u^]t[Gygh<|!D* +x䙯U$~^o!=k+ّ7K#H6J9dIjS-.4ځ.{s$Oj0]>x]o0"Cwps hmuQ O ;9rӼo靾xQ #T +3gSa> [=)zE0O[PҲU\}"ux)J d:~kw8,sCRXI D,~ؐf$c˶1!DWm Ɋ Yh}69R/o&E ;@Oh=8'-^۴?Le7&s5ɢ/kRK1nUU"غ,YcJUpmJLN'/[#_[#0X|C;ҁW߯r@1*s"ғ%;)]Pk"{͢S, C}{ \zNFD/YX1 ~yU}{neDR $v){%vFwJ/Qx; lVjFe]f~۱ZհX&{,\Ue&튔9 fyuMD\1)c~xMAE׍c7v ^5`75I!9Rc ._ > 9:%H E^b G^:duNe4.Iz4d UD*^_H4+Ըn2؃|"0lZFurxJ“eB#?{5g&& )kH1KD4ƾ-LPv2|DwyHGsRL|M>5dϓP ( 5&L-I0Rh^[5ԋx$ \KզZV6y̒Q5XXQUcwW܆9o}#c=!ѭءoRoX]a[JgoH:@) P.;GCN']O>Kgzz߉mGv /13Ckkݩ'שi 1zmއ~1;|; % wZaLw`p`i*,SguQkm]D7d;ҁ\ :E}clV`}SUii!}hA/!K ({8wQtG *:_c:yT @UЃ7`j"Hv@z-0ٗ/ ĢPz 8Lbq[/L]W LWdw 싷}>'̍LX۩ipmN%K:)l6J\ѫtT+T0Q*׀K+3dba(?/w?eM}Uй!0PH v2+"!Gn ,94u' iRg](mlJ 2|)LڮT##bɕ҂kPMq.sF8>o=W-Oo <%Oi >J?^4xtϖfla[YXS}CEIH қ|mgD_<>jUS=6Cg;CD`cMRbwc#D[ #b^'/]󝽹:w0 #08HB\P*=qa?eD+3 ӶtE!ֆ5nt[-wiHc28ekH(Pоڥmx I4]Wz.vTd݈~[/|[Sh[O|Ӑ %iun4 0}-) ".TO ,<#a'O5l_2/ٴWt){&YFEԆ}SD'EjV{`MӜ_JwS=9t\˜p()e 23>"7j:ucϋzI^2&7z430l?dI7ޝOÇ& ^$ﱔ\y ,6c’6y>ȁ6%r9&v,;9W !ʯi|R^Y;׭'mx\INp[)rC@Ηk  wzrP 1B*В B~~ M/Lgd 򡖳y:X/[@W6ACQUeY[N[x,S~HWe:FwΒO`W8MOk)[BЉ"8٘&k0RS)U*)IɷrO~^H=ňmQ8HV6 D۱Cu 拫ob}!giUx |.y7Op(CC!-ddEhjNk"[&(g!R%.pߖVlhyg$(H.Vmmy΀0#n@:Ja"p& F6,lX%NÇPNSU 1]\ѣIE,f"#hu /g鼪a M+ȫpN%7"݇o{LHy('[jDŐ0PA ADe:8]%ΥtL; 1.C`A2݅U8j8-(AxBcŠr+=]֤*1E2@*Gݿ(UNH7=W ,ʺ0jQڻ?r$O-%᪻{!Pu| $#tYd 5't$m{ն  q#"{; ;t8<k"- ogF{uF8_R}PC5>y{\t$ùLTfSyr*6V^-U JUr.`n Y㞺CمC~R]{_zTvkSIzXD q&w3!;'vBA2J7i]Tfy3I>' ELe3lL$ M)m5sS2 U<*1O ɷ hYAbŠ[i !g7pO^r3 rx;zczqμ8@XρgV~MEkeU\Ib(|uBfQS؏Z(M"S@ ^T4?tWIMћAɅD࿮m_CP8A?A݂*8ILy DDG0yIa(bi"_̗76t]"tjm̙Mrd,fIiGb.]q Pzq,\䪋ٵNoi0>䩻XA•oC 9Xw|6 :l)m5_"4X79X]4<Jrt_b:jӈ |['Wvz+fB5*$T.`.ub= ^&"t#Ѧi A/J/bI`c%Ek9 u'Y&]@j6(]IU } 2aVFw6,@"Y? @Y I6řh6"8X*h!&Jz'5,ý+Ɋ! !r3Wc֟ih_ösw1/h qξUB:0F J2 >B˘K cf im)lXͳ| гSvnew$-Ju4tT%h=s9MidHmA?b")C78`qZ{@^@TCu|瓮& "Za |t<5*yLUٞ >R0T<0O!쐅7St)皮->bLa 3Xh]֔\"~w/EA^3 D[q9ѺPW\BNчRK4%/6qeL"5gh& [;43du چLN _}%%;K6hH^tIG7l޻xbdgsZY<(") 34k3܋*MF"t|c;p#H@7w[ _xHauڳql՚rq|eup4<0 1/2QVȦe.D7fr.RLPlv O/IEq saJ=<bӵ@JH`*;<=i|j~dOԋ ]vJR\8u-cw\^#Lx ',=gyQ 9X_t%3 X5K7͎v\Rs硞y($G  t[.qI=L :Of{ҥ8{";YT.Y|{6v]tX(]' nxPgarq&])ӶgyTń̛RWİ$v-y"ٜOL&`b ש$] ؒlf5 '3<{4/D9=J͜7ҠSI}7%n.eg,O?GN+? &JW!5.ŖG8!R7}t&My`ݨa  yoYSq/FZGG55Y߶ Ngqxᚭ!ZKc&z+qo _q}m%IrgI7AboƽBR8&}"\/1$}g S^[&r< 1Adi8t0C/?T3oTe\L n 2SB$@~N*0pa[nCxӜ)((@dWDgM7sVbJ!Rdr厅oanC:͍2 d(ݪ0-[/ [E%LD3*.iRȦ}![b܅+Y9ޚVӜP^_=g-Qvw02UNd{_XFqm^b"E\V2N4@ˡeqq'6C+&'HQ]=WX}AUŜ$7ex ]cMf)ʎ-m ,T2BN'(cW$Ԟ%O#3H}޷V,hK󋊭7LmG!.E{-sP$TƣBGN]1'c~WtjpMn K3bVXxe\k C:P\]R {f,+Tg,P ?8*[z_36!zs=X#(XsG|2EɇI)Ϊ]q40=񞯽R*sCf,VK-GB˜F_T8Uw.eH,`l<ĵ/<UY7 ^3Ly*S3N{.xòkUSp2\:0 *;sa\VJ:su~(f(4rvkK$2? ~Lp\4G*a1GQ¨lR4Q9q1$J/Z1fz1/B1hU/'RNK]Ar68ܪwKqG 'ze=?o |PF%NlRO6Bbb[ ,xOOK۹1zAC>] x:3#a`@]u'& FSuF/-4޶z _+2U(6c1#]]1]@&6;jҁBD| JVkX?ባǂg>3a df*(Q*0}پv{h«"?@-CD kxxx<8b`\>,b$$.8(hYZY=6,SU~ iWm1e(} ExK Jcܽ&|' ]6o' IO¹mc< kKh}sR+PUNApЭ+П2܂32M2Fu>v3փ2Xk`~]P)\uu)g:zx:X^Bgm{ОK5>zK _E[􉧍LXeeR׬^ݓ&:V,xk3b9oO۾pyH̹$]p02pɭXM/[X9299Zy)92rxlvi3jZPvIkI2dW$+[ b7FHZ‡lKZ`18$wb"{U^ul[H~Q(dF*`~H25KWmȌȽ6J~;ag[,؟o %k娆0n!#=0C?էbĐ,/]a"g ihbƕN[ ~s_ߘٍ{Pb+f~A[ϴD~98TQsw$8wyUaH4vfad2s`.L ,# RSJ?^Pa]M̌6:}4iTx O!2pXyAKf-yE;N;N1ei'"vhY3B႒(֧ê~p}I_ qZYKuѼ>v/lkqSe.}{uvrz!l!{?F4|N@+B8`A/Kyab)o'1l G%I I=B\sFHo99 2$u4^R'{Ǣ:_O쨵$ FlWa7\ h8GX~=i 6)kNt,?\HƽB75q `m$m#ZfUM**4rE $#cZB(Μs| xfmZT@tMܜXɿ*9`xŮo:^f"JA";Uy  PWu0P`KI_(dW"n$~`ljpSbapl>KJ]R{8h8zkS`睵#$jϧARSeGB݌%z-a-ˡ`@fؖC3 Woh%Rœ3ҥ7=tWۇG* y=Zy&#IB (s{8LS߽7ݪ4{ ,]Xj Nܷ@c9$RCI8֌I@ ՕN ;婻}р/}qbcQs!pFcXRM) v^X9qG&"A ~Wݷm>c P"a8L|t߾惻 zlcg}z{Qܼz֠kF(a^m3Ͱ=aڹ oLz ġ'M/5)) $H݀s `燆1oN#~YR}R ϶ΡO Ê5 AiHe#)Q&&xD;s`7u*:#ٲPtKx˙3Cfiԃ4:eLċBv8cH@zbJq2҅`OC{C^V m* 6G_x 0,9yX@gL2uS7';_)Y,UW9.Tiq&ת;egMu%y9=􊋳o_X\k7oV&h2C""ਅqzӚHpoX`>V2dfN&rsB# X'B[+h[8X)4aPe ְ1L#O@HMɑ6lb$JDkX~dο#;S\,9:; G*[F!yx@6sè s$HZ_IA%3YNf =S -ONdfЎ8Wv4c!gTVn$Iu}UT_ÇeckSJo"9빼mIm }+B,Ω_VӾzAH/k9> eVwdE`ɮB?4簷 ᰏQ5ӑr`89(clB[W٥`ĘͰZ2g踰.%7z̘ !*n;Ÿ,pԋoB_֕)êF1Da'bnBFXOc`,$E0E&iLeybKt H!9F_J (f/C` &5ó)XY?s2|,E*m^X$U)/ꢢr˟$ksDEב9;ܴ diw2uƒa7Ayr]!.Mŝ`gaNm驊hv+=b-cIL: 70mʁFvdQE0VKWI"KlbL7D6xVVJW:3G0V@3|nXk4H'MoNBB{C,&4o>;r:ՈFC뮡qr<X{",c衳 fylT _5up wJv<@Uw9Ya촹2J{}%ڨ'!ԙC drwq<oG _f~2·)/r@] |놘..~,9+8&U}jtFSp&1udJej N- 4މܪT㭰8ie eN1_:דKrξsibgXYD*#"C~ Pw3E/zq[5] (KXs` =Sl]*M*bsȥ19U(R1WolO8~gIÖ>"hUSji~ftj"4 4 X\2 x TpA<9z13MuE$nĖ$gF x=.Mq&o*4~R$#Pm iUuDk&avNi8_f1ppY})`*FsBK YfŻTbal .E&7V͎DPnS4dƃN܏7ߪMeF&(9C#X(m3&gǺpz2̈́2MlE; &2cNn ]z jB,JHtLzp;ITLCK@ 9X{9)/uα4{.N VЁ<??/HtQl": QkJo1P4LtkP ̻,|ec*w+=GR TM/gǛz7hqmW 7iݩ( 6f|1"xlt>3.IWO4p֋e6{"*}vt7 CCsPW4 ڏj ;=^A,ME,lNA6FG(hws(O%ޢjes-t`Juמc,i\ζ&Aړ˜k\ڹfX֋kYdkIP  l$hwla@3oTZѐN E.SaQtF[ZшJox%C* N.jZ ymT>,+l %(qZRBsb詄8؜{VwKyP+3+s9lxqK,8^ulަUwJ*N2-E Oб1~L.q0W:O&D_>2?B6oYꐮ0mpS]- Bf[[qt% x.+ be蓋WjOFjˆyH IP G8G|L\ȹq ˋP<&Py` 0"w H2I l`I$ws͓lE3Jxn#v)^\ {Pt2|V'0f !PuWѝºΞ MB-)ۓE{6af>|6kv/c(yEV “qMa\!O n+ gL'D=xf()o)7OE$X֫ޟDU`@,uB"ZVP}smjsn9[aD=]0`և)Y[8zU LSU|_6TF>p1~EZ|Q @P.P$/a~XAh`,eBYmZ᷽g8=,J>;ɥADZ:ۚk> \ֲ=*8tj&ߙ5,H= }@WV*-:mb`S:80Ҋ{ 2 u NKP r[]ol!C#*v!2D$wA"s1ݼO%0?)+̣) 0.o`QR%JNR:d<Ej;6#qœ:63pO3{z%y5KIyi.XtP[qEx 42=u1'C> ݽg>] @!傢X:H1'\jd<3*n8cQWWR_RYnOe33lw]7jhI1J.:?"Yoɶe\3 c0C=1&P~!TsN/"];-0TᅘP‘6ڑOybU߄.JYLɵIAtzcE B t:G!"Hl|M`8Ci75waWCZc\<'amlC9vQۂ7oX8:\#{<]3`WTa1x74T=Hש+, /WȕmEkR7MKzor7M aܨ;^ ,pl|Q@>Nt uR (1hX,rR ak/r{}coJvtm74z 5㛯${tiw7|g5 3'O톲u _MUj<iҤ'w5Ifp󰦓n\Qf j:J{cD-'AfN[ba/ }e Ȧ̶0Cgߟە p7U@1XXu߆L_ R2c*wmuW+(ߐϺI߸a~Dۋ{;DXx`%A ɿ>"[@6"Թqvo\c/U7m 50ks.5mt-ҍ! E7it '#"S*Q@jrMYZXAru8=mq3 +[/hZJI \>5#4eRɪ5Nm%#IH25kѢhA?fǍ__h4d6%+"y&tv󊬌(Ah~ O@#3 VSO%Ps8*`iDK\ikGaq ‹!Z][AEg49í{!dQL02P&cQpkX|2hzpJֳEk._|ә)-rmV'UQwB dB 0`"`B9d5O#צ;GL1 70[N½EZf nU\''(Bs{>v8hO9fL<S3:v]'TзvSЙ9r.0?9QF.V[XI5+w uxR֐'ؚ {U/UxF`h{r=FD7B͹LuV #yDBm98Ь;Ƶ%ūK5T{)g+Q4&"lN'y C@׸Ez_(U!:9< eߕ>\F+#^\rK,V;P4$c}L_f==:l)bdboL;^5onJѧ%s7ELGۆ$س)=A+ӐX?pI>VAځ^ Z+ dcvb*iXo$˃\[T._́ 9=A0(Itd.IڠdgM&O}/IrL_lyɒ  Vp*6K$|}iT翗gcK; |r# W<֤P`¤fϬaVV82AOJ,?+UN@K苛7a!Cf(1΂/ciY@HDdZݯXQK;ND3ŠQ_nwwOA.scMFiҶ3+zhii$PY)kAAʩsm^Bp^YcD<7Y륇˅%^j:)_ !4 mW*>k)rCژQ. 4Zq >ɖB?FeXِlV2Ck 9Kl#\W qvRva R02|\P (I.c3e1 >g>(GC~&/ƬaǬ{@} d>PKjw,lJHC2i4nNWE)bڻ58^8'lψ, 1n^|bƧ 8$ ޹ 9`sbḴTyhG tV[gvegQZ] 5/B_ZcX\-P 'EF4fq۞oGC23G>;,=q]ʻZ3CՕ:flkDU*;zyt59͟?p &7^",̇=sLn0kQpEeT4 +@rq{Zٍ'-'k%ݍrEUяGfpCC6H1Ǹd#̇%Ɔ/XjPoarb3\k[՜pub PN7ˢpA&e!¨` q+:䡘wjȗ6r9J3TO^E8֜'n"}\usl@B'}awV 1RO p3{(ySg$=OS`~YQ^vord$6UW+?ً: 6^iL|Xl;V DaHI|it1sp#n0e#"rUh+DZ6R lӑ'YQy7~m|jUMWT鐲bu:HE[fCLdY|̆E߈$}B$)ԥj|<VPr"p|(ktԧӼu1aq5[Wr?hmXZ! [1z71/SΠa{(v*GlMK$&iQ)gC!9u]ʲVkn/ڟ֔Dgudۿ0"^paOgHWAb>.%q6زʳ*wh[ xq} >!مoBEe—[SadxϬ. }/HcUNa hd9c2NS]pGF\{r_j+ۯF[ojH yM*^fAкڻ: _cUqxgjoOwBaaRVmdCI5hj@DY2UN#z@me^\;vQ6՚.tj:= 2V%$4D:.tU@+*Dpj hP Cr> rv6t_U6Pi}20! Uɭ[ԋ;M\# xp~X2$ dDKRc# Gξ6ѢaAsx n'(JO,K<)>BC*˪;jrBk{ qt!@\hCց뻤PEΜCPoULe఻t8zBʴT")ASFcwԳ綊 9 Oi|2gZh 3~pC&#T#8L{J|8bpeF f=]@>5B-!2nCםo;ڻqMSߋ~a444oKH8gdQC=:O*0WkZyd(}e%N#|9}SH7P4yt"FzYfkAFXS/߃p 7ry7xnM/Mʾ4O6*؆&z3}=2%w'I,;b]@i},ࡉ1 _6A%E*VfZ:=gN4583Wbyj9;uVVo!N2blFdE$=ne(RUtY/;=U$E0Yl bWV_fo+e*!:;7q`5:(9KM^ln ̈́HB$xJj 3;LlmT@qBNi`1x "W ԰Aj!5kf pWITQ5Z,yT~jt/ .:+f΀ 1m0#֛~ldzOs6Mne^G0.o[[P=C6Ǎ=ME22~㨑]^2HRVܢi[RݗH|z'˖ߚ%-ءXH+XYRL$ӧMqzJeoC}WJ(Jul?EZ={Gr4~2Ҋ=ŕ0dP-OJF+KP8AFr^JLA(qyi9GiLny/\THթ I,4d0 Ѧ~<,W{ztZ΁9{F&iGmfI\O/ԷmX?s\Eڴ_:-%wtP_9Ys0.]Qn>:Dt#_CtJ$|Vo)YŖn Z⃘Eh7F!G{NOl :D% `/8oCe[p;Rv|mِ4kS ₷@㈔/GjOZck[*^xԎ az }C[L԰E׾!t__r ;x:|]J#"1E-aU[kkWά= Z5MA })454m]g{j-7%x{Ae/5xh[~S޽iSL_3$_ѤQ}M6¯L7ھTSXC|jQ609%>inz7Qvw5Ԙ\5E܄(n Q Ȕ/jwUZ-ѽh1ǔa&>xNakdAs.޲9 1]Neֈxjl3\]dG]hSEqe FҷXce&uLi{x7?O?-asE= ZrݧWz .l5^DUEϝRνiy/EF22)8'c @NYa0i2=:Z|/{2"Ô7"FS;''Ȯed"OeN%6Pe#""?xyڕaxE&ѱQ`|:pt ;r+r£S)nJ< zDF޲b('= D-/%o^3E8DN͂PoE@Wo}"&V8Y !0 46#eY{QZ$^SoyP÷*gFBjTD.! yHH\2IG'jKt5EYTӌs#aFۯ-w .i;bw^ STt8]lkc–x7ʠn;EN1\(O>,Qv0}bkd*ya6->- j;;\SGꢗ%%cJ@6Ul@H3GRf"nWV ;)Nn91ZH ;Qx>,:>O)ѭjs.t29ˆL<30 k&"\1TC9PiwC$xju ;?.M 'نśѣԦjz?3`IK p'ӳKX!l!0>;)V'pt"Y  h<1)g|#'-4`YKkҔď!47D%9g<ׂػVׂ`Z9.R9m"n2;5>#BY^%um͗䈒3@^hS%ݼ|:_2shsIg2Kpq}9-Tr͵$}LYBlu =AyAz,Fgmry)V1m>}6ZӴqj@N*x#=׆@Ch.pT7urf'1 H5/ %Z *O$sk~9.}cE=\ǼyKtonD希A,}Zn*'}ٌ܂$$2BvlS@yg? m( [', ȄNUO8!`g{Ǫ @n:t.k&l݌Cʹv-FhH~=!R=ó{O vBr)fz3澣^[Lօh+L<>lx6)1} 17bl7&BX&{յ%n–a[+{+Me_n'vUOcӼ9(d]7U:@#nhׇ&%X *H$}7Z9xK-\zıv݉r>3ywF]ĶtÀ/ V` 8+msiOo=r4T4`[>3ELYY=x3m|G]%17"pfmEP78\ Wig\5%9w,PMzRZx4ogR f8Cgqhg|{qxYg`_gK{UU lU܉s$cW'uG^ًcڂ%W5ÂZcJZD rҴx}LL>mIN0W5]MUt2*4$cf.W\%\EJ4:TALw9OyVfz魋pw[:pqu"Z=dOb<@w$ڏi6K m>'XMQ7 ) `qd?^|;A-*TrFe&;]_;JEU]Ԑ  8?tXJa3BBljHAg*"8#LRA v|3/2, 9h7cJXa3!N7r3v!' "? Z|fؒw gD-g܅Tj}ew$/ c7R/UҼt<ŽdysOq]%/q=(1<ưC ]2n o|~ Ţ8Ưư-qfSmٜ6\fEr+J\K^k;M55G;UU$C:iI0e -*Er@>,\ Zl/-־(J孶.cR41QZ$AYf 4-h2#E؜T}!Ax,x̖ ߛJ 2TiV]XA t*>8-(rXev 8uNo|.LzAC\Vqh9ܟGl3zVӹT0d ӽ7QdI}Q2@E3aû#Tb W} Bu#B;܂gH] " D%8AK4Tpm߮H5);+dOQMT(EFRj\HiqN[)wMXWr/c[%lW)HMbkD_h z2GX2uY&拔YgZ%gTj/:/G?Pn+en)4:AZl^lϤMOk0/LҴKާX9`Rd#O;G q*$])U73=K^"f>`wRt>! OXaksr`Aoz~J]sӵN41ʍJ'j'v}|?'iy!s6:Z#>`'@$rjy cncs_oܡΪ!H߭hedaСC;7HwG޵qYI;Bݖ~HvRmk[Pʩ1bEhnPQͽl}rh dq䴶\1}148 ^;A qW1᳐ ٹ]gYZ.shstrtab.note.gnu.build-id.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_d.gnu.version_r.rela.dyn.rela.plt.init.plt.sec.text.fini.rodata.eh_frame_hdr.eh_frame.note.gnu.property.init_array.fini_array.data.rel.ro.dynamic.got.data.bss.gnu.build.attributes.gnu_debuglink.gnu_debugdata 88$o``D( 0`` 8oH(H(EoH*H*8To**cP,P,mB   w@@r``}00$$xhh ?   Ll`r `r QX#X# `C`#pCp#C# eDe$gDg$(pDp$ OHN( )  GN(l\S(8(S( (7